TkA01G054320 | RubberDandelionOmics

Gene overview

TkA01G054320

Reference: TK1151 Chr: Chr01 Coordinates: 14033160-14033709 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

501 bp · TkA01G054320|TK1151|cDNA

CTCAGGTTTCTCTCGGAGGTTCCGACAACACTCCGACCGCTCCAACACCATCGCTGTCTGCCTCTCTCTGTCATCTCTCCGAATTCCAAACTGTCCACCAGCGAGCTTCAGTTTCAGACCTTCCGACAACACTCTGATCGGTCCGACACCATCGTTGTCTCGCTCTCTCTGTCATCTTTCGACACTCCCGAAGCTCTGTACACCGGCGAATTCGAAATTGTCCACCCGACAATTTCCAAATTGACACCAGCGAGCTTCAA...

CDS

Download CDS FASTA

501 bp · TkA01G054320|TK1151|CDS

CTCAGGTTTCTCTCGGAGGTTCCGACAACACTCCGACCGCTCCAACACCATCGCTGTCTGCCTCTCTCTGTCATCTCTCCGAATTCCAAACTGTCCACCAGCGAGCTTCAGTTTCAGACCTTCCGACAACACTCTGATCGGTCCGACACCATCGTTGTCTCGCTCTCTCTGTCATCTTTCGACACTCCCGAAGCTCTGTACACCGGCGAATTCGAAATTGTCCACCCGACAATTTCCAAATTGACACCAGCGAGCTTCAA...

Protein

Download Protein FASTA

166 aa · TkA01G054320|TK1151|PROTEIN

LRFLSEVPTTLRPLQHHRCLPLSVISPNSKLSTSELQFQTFRQHSDRSDTIVVSLSLSSFDTPEALYTGEFEIVHPTISKLTPASFNFSPKQVLGSLCRLCRRSFKAAFHERPHFIYKKIHDQSHHHLISKINITVNFIFVTPGKFHDLKVNSLVTVNYLTARLVV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G054320`
TK1151 ID	TkA01G054320
OH-1004 ID	LXL04_027961
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	66.700
Protein coverage (%)	TK1151 28.916 / OH-1004 16.054 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G054320`
Location	Chr01:14033160-14033709 (+)
Description	Similar to RIC1: Ras-related protein RIC1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_027961` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000045 autophagosome assembly Biological Process GO:0001675 acrosome assembly Biological Process GO:0006886 intracellular protein transport Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006897 endocytosis Biological Process GO:0006914 autophagy Biological Process GO:0007030 Golgi organization Biological Process GO:0009555 pollen development Biological Process GO:0009860 pollen tube growth Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0016477 cell migration Biological Process
KEGG gene cross-reference	ath:AT4G17530 dosa:Os01g0558600 mmu:19324 rno:81754 ssc:595116 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.455

Rank 1 · TkA01G054320 · TK1151

Cytoplasm0.446

Rank 2 · TkA01G054320 · TK1151

Mitochondrion0.094

Rank 3 · TkA01G054320 · TK1151

Cell membrane0.087

Rank 4 · TkA01G054320 · TK1151

Endoplasmic reticulum0.074

Rank 5 · TkA01G054320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12560RAG1_imp_bd93-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G054320	`PF12560`	RAG1_imp_bd	93	128	0.085	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card