Gene Card
Gene overview
cDNA / CDS / Protein Sequences
953 bp · LXL04_027961|LXL04_027961|OH1004|cDNA
ATGGATTCAAAGACGATAGCGTTTTTTCGATTCAGATTGCTATTAGTTCGTTATTGATTGCCTATCATAAACCGAGAGAGAGACGTCGGCTATCGGGATTGGACGAAAAAACACACATGTTTACAATACGGGTTAAAAATGCTATGATTGTACTCACTGTTTCAAGTTACAATATGCTGATCGGTGGGTTTTCATTTAAAGGGTACGTTGATGAAGCTCTCCAGATAGTTTATGATGTTACTTACCTAAACAGCTTCAAC...
900 bp · LXL04_027961|LXL04_027961|OH1004|CDS
TTGATTGCCTATCATAAACCGAGAGAGAGACGTCGGCTATCGGGATTGGACGAAAAAACACACATGTTTACAATACGGGTTAAAAATGCTATGATTGTACTCACTGTTTCAAGTTACAATATGCTGATCGGTGGGTTTTCATTTAAAGGGTACGTTGATGAAGCTCTCCAGATAGTTTATGATGTTACTTACCTAAACAGCTTCAACAATGTTAAGCAATGGTTGAGTGCAATTGATCGATATGCTAGTGAAAGTGTAAA...
Protein
Download Protein FASTA299 aa · LXL04_027961|LXL04_027961|OH1004|PROTEIN
MIAYHKPRERRRLSGLDEKTHMFTIRVKNAMIVLTVSSYNMLIGGFSFKGYVDEALQIVYDVTYLNSFNNVKQWLSAIDRYASESVNKLLVGNKCDLAESKVVSFDTAKRCWFLQCAPHAQDPDPTHSHKHLRPAQAFFPPSFFDDSGIVSSHLLHCHPSILFTRRLSAFHPLHFPASISGFSRRFRQHSDRSNTIVVCLSLSSLATPEAVHTGEFQFVRPANSKLSTSEFQFQTFRQHSDRSDTIAVSLSLSSIATPEA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_027961 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_027961 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:27753587-27757940 (-) | ||||||||||||
| Description | Similar to RIC1: Ras-related protein RIC1 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0000045 autophagosome assembly Biological Process GO:0001675 acrosome assembly Biological Process GO:0006886 intracellular protein transport Biological Process GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process GO:0006897 endocytosis Biological Process GO:0006914 autophagy Biological Process GO:0007030 Golgi organization Biological Process GO:0009555 pollen development Biological Process GO:0009860 pollen tube growth Biological Process GO:0015031 protein transport Biological Process GO:0016192 vesicle-mediated transport Biological Process GO:0016477 cell migration Biological Process | ||||||||||||
| KEGG gene cross-reference | ath:AT4G17530 dosa:Os01g0558600 mmu:19324 rno:81754 ssc:595116 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00071.29Ras56-110 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_027961 | PF00071.29 | Ras | 56 | 110 | 2.6e-13 | 50.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.