TkA01G050830 | RubberDandelionOmics

Gene overview

TkA01G050830

Reference: TK1151 Chr: Chr01 Coordinates: 13166954-13173438 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2304 bp · TkA01G050830|TK1151|cDNA

CCGCTACTCAAGCTAAATTTTCAATCCCAATTCACCAAATTCATAATATGTATCGCAAAATCTCAAAATTCTAGGGTTAGGTTTTCTATTATCTCTTGAAATAATTTCTGGAGAAGCTTCACTCGATTATGGACAGACATAGAGGAGGAGACAGGTATGGGAACAGTCCTAATGATTCTCATCCCTATAGACACCATAGAGGTGGAGGCGGTGGAGGTCCACCACCTTCACGATCATCAGATGATATTCCACCAATGAAT...

CDS

Download CDS FASTA

1203 bp · TkA01G050830|TK1151|CDS

ATGCAATCTCCAGGAATCAGACCAGCGAATTTTGGTGAGGGTGCAGGAATGCATGGAAACATTCCTCAAAACGTGTGGCATCCGATGAGTCAGCAAGGAATGGGCCCACCTGATATTAACATGCATGGTTATAACAACCAAATGCCACCTAGATCTGGTGATGCAAAAGTCTTACCACTTTCATCAAATCCTCAAAACATGTCACCTTTAAAAAAACCAAACCAATCACCACAGCCTTTCTCACAACCACCACCATCCAA...

Protein

Download Protein FASTA

400 aa · TkA01G050830|TK1151|PROTEIN

MQSPGIRPANFGEGAGMHGNIPQNVWHPMSQQGMGPPDINMHGYNNQMPPRSGDAKVLPLSSNPQNMSPLKKPNQSPQPFSQPPPSNPIRPSGQPTGQGQQPPNSSATQSQTFSQGFPSMHGGFIPPPVMNQYQVPGQQMGAPPVHQSASPLAQMLSQQKQNLQASYQSSQQTFTQLQQQMQLMQPANPNPTPQQGGGRASYGAPGGKPVTEMPGGGAAKCNWTEHTSPDGYKYYYNSTTGESKWEKPEELAVFEQQQKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G050830`
TK1151 ID	TkA01G050830
OH-1004 ID	LXL04_005429
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	93.300
Protein coverage (%)	TK1151 92.250 / OH-1004 48.370 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G050830

Location Chr01:13166954-13173438 (+)

Description Similar to FCA: Flowering time control protein FCA

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g16280`	Plays a major role in the promotion of the transition of the vegetative meristem to reproductive development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BCZ8`	Plays a major role in the promotion of the transition of the vegetative meristem to reproductive development (By similarity).	No verified direct reference in this release
`Os09g0123200`	Plays a major role in the promotion of the transition of the vegetative meristem to reproductive development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005429 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000398 mRNA splicing, via spliceosome Biological Process

GO:0008361 regulation of cell size Biological Process

GO:0009553 embryo sac development Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031048 regulatory ncRNA-mediated heterochromatin formation Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:0080113 regulation of seed growth Biological Process

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT4G16280

dosa:Os09g0123200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.891

Rank 1 · TkA01G050830 · TK1151

Cytoplasm0.232

Rank 2 · TkA01G050830 · TK1151

Cell membrane0.025

Rank 3 · TkA01G050830 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA01G050830 · TK1151

Mitochondrion0.015

Rank 5 · TkA01G050830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08501Shikimate_dh_N143-182 aa

PF00397WW221-248 aa

PF23517WW_TCERG1228-252 aa

PF03374ANT266-305 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G050830	`PF08501`	Shikimate_dh_N	143	182	0.21	12.6
TkA01G050830	`PF00397`	WW	221	248	2e-09	38.0
TkA01G050830	`PF23517`	WW_TCERG1	228	252	0.0011	18.9
TkA01G050830	`PF03374`	ANT	266	305	0.27	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04425`	Arabidopsis thaliana	sp\|O04425\|FCA_ARATH Flowering time control protein FCA	72.300%	Swiss-Prot	Low
`B8BCZ8`	Oryza sativa subsp. indica	sp\|B8BCZ8\|FCA_ORYSI Flowering time control protein FCA	75.000%	Swiss-Prot	Low
`Q6K271`	Oryza sativa subsp. japonica	sp\|Q6K271\|FCA_ORYSJ Flowering time control protein FCA	75.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card