TkA01G048970 | RubberDandelionOmics

Gene overview

TkA01G048970

Reference: TK1151 Chr: Chr01 Coordinates: 12658858-12660198 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1272 bp · TkA01G048970|TK1151|cDNA

CTCACCCATGCAAAATTGATAACTTTATCTGATCAATTTGAGGTTTATATCCGACTTTTCGAAGATGGGTAGGCCTCCTTGTTGCAGTGAAAGTAGCGATTTGAAGAAAGGGCCATGGACGACAGAAGAAGATGAACTTCTTACCGATTACATTCAGAAACATGGCCATGAAAGCTGGCGAGCATTACCTAATCGTGCTGGTTTGAATCGGTGTGGAAAGAGTTGCAGGTTGCGATGGATTAACTATCTTAGACCCGATA...

CDS

Download CDS FASTA

435 bp · TkA01G048970|TK1151|CDS

ATGACTATGAGCCCATTAATCAAAAACATTAATGATCAATTGTTGAATAATCTATTGCAATTTGTGAACATGACCCCACTACCAAAATTACCAACTTTCTTGGACTCATCACCGTGTGGTAGTTTTAATCAACCGGGTGAGTTAGTGATGGAAGAAATGGTCAACCAATATCGATCTCAAGATTGGATGGAGTATGTAAACAAGGTTGATTTGGAACCACGTAGTGAATGCGACTCCATTGATGCAAGCTTGTTTGGGAG...

Protein

Download Protein FASTA

144 aa · TkA01G048970|TK1151|PROTEIN

MTMSPLIKNINDQLLNNLLQFVNMTPLPKLPTFLDSSPCGSFNQPGELVMEEMVNQYRSQDWMEYVNKVDLEPRSECDSIDASLFGSYGDGIEMIPDHEPFDNLFIDNQLPGLLPMSPEEPKNSLESNAFQAGFDDYYDSLLKI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G048970`
TK1151 ID	TkA01G048970
OH-1004 ID	LXL04_005447
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 48.649 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA01G048970`
Location	Chr01:12658858-12660198 (+)
Description	Similar to MYB17: Transcription factor MYB17
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_005447` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006952 defense response Biological Process GO:0006970 response to osmotic stress Biological Process GO:0009611 response to wounding Biological Process GO:0009737 response to abscisic acid Biological Process GO:0009908 flower development Biological Process GO:0009909 regulation of flower development Biological Process GO:0010345 suberin biosynthetic process Biological Process GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0071365 cellular response to auxin stimulus Biological Process
KEGG gene cross-reference	ath:AT1G34670 ath:AT3G61250 ath:AT4G17785 ath:AT4G21440 ath:AT5G10280 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.870

Rank 1 · TkA01G048970 · TK1151

Cytoplasm0.295

Rank 2 · TkA01G048970 · TK1151

Cell membrane0.030

Rank 3 · TkA01G048970 · TK1151

Endoplasmic reticulum0.025

Rank 4 · TkA01G048970 · TK1151

Mitochondrion0.025

Rank 5 · TkA01G048970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28620EFCAB12_C50-71 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G048970	`PF28620`	EFCAB12_C	50	71	0.29	11.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card