LXL04_005447 | RubberDandelionOmics

Gene overview

LXL04_005447

Reference: OH-1004 Chr: Chr01 Coordinates: 164261593-164262553 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

891 bp · LXL04_005447|LXL04_005447|OH1004|cDNA

ATGGGTAGGCCTCCTTGTTGCAGTGAAAGTAGCGATTTGAAGAAAGGGCCATGGACGCCAGAAGAAGATGAACTTCTTTCCGATTACATTCAGAAACATGGCCATGAAAGCTGGCGAGCATTACCTAATCGTGCTGGTTTGAATCGGTGTGGAAAGAGTTGCAGGTTGCGATGGATTAACTATCTTAGACCCGATATCAAAAGAGGAAACTTTTCTCAAGATGAAGAAAATCTCATCGTTCACCTCCATTCCACTCTTGG...

CDS

Download CDS FASTA

891 bp · LXL04_005447|LXL04_005447|OH1004|CDS

ATGGGTAGGCCTCCTTGTTGCAGTGAAAGTAGCGATTTGAAGAAAGGGCCATGGACGCCAGAAGAAGATGAACTTCTTTCCGATTACATTCAGAAACATGGCCATGAAAGCTGGCGAGCATTACCTAATCGTGCTGGTTTGAATCGGTGTGGAAAGAGTTGCAGGTTGCGATGGATTAACTATCTTAGACCCGATATCAAAAGAGGAAACTTTTCTCAAGATGAAGAAAATCTCATCGTTCACCTCCATTCCACTCTTGG...

Protein

Download Protein FASTA

296 aa · LXL04_005447|LXL04_005447|OH1004|PROTEIN

MGRPPCCSESSDLKKGPWTPEEDELLSDYIQKHGHESWRALPNRAGLNRCGKSCRLRWINYLRPDIKRGNFSQDEENLIVHLHSTLGNKWSRIASQLPGRTDNEIKNFWNTHVRKKLLKAGIDPKTHKPVPNFDFLLETISQISLPFKVPTLMTMSPLIKNINDQLLNNLLQFVNMTPLPKLPTFLDSSPCGSFNQPGELVMEEMVNQYRSQDWMEYVNKVDLEPRSECDSIDASLFGSYGDGIEMIPDHEPFDNLFIDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005447`
TK1151 ID	TkA01G048970
OH-1004 ID	LXL04_005447
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 48.649 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005447

Location Chr01:164261593-164262553 (-)

Description Similar to MYB17: Transcription factor MYB17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17785`	Transcription factor MYB39.	No verified direct reference in this release
`At1g34670`	Transcription factor that acts as a negative regulator of lateral root (LR) development.	AtMYB93 is a novel negative regulator of lateral root development in Arabidopsis.2014 · DOI: 10.1111/nph.12879
`At3g61250`	Transcription factor that may play a role in flower development by repressing ANT.	Characterization of Arabidopsis MYB transcription factor gene AtMYB17 and its possible regulation by LEAFY and AGL15.2009 · DOI: 10.1016/s1673-8527(08)60096-x LATE MERISTEM IDENTITY2 acts together with LEAFY to activate APETALA1.2011 · DOI: 10.1242/dev.063073
`At5g10280`	Probable transcription factor.	No verified direct reference in this release
`At4g21440`	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable).	Integration of wounding and osmotic stress signals determines the expression of the AtMYB102 transcription factor gene.2003 · DOI: 10.1104/pp.102.019273 The Arabidopsis thaliana Transcription Factor AtMYB102 Functions in Defense Against the Insect Herbivore Pieris rapae.2006 · DOI: 10.4161/psb.1.6.3512

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005447 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009611 response to wounding Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010345 suberin biosynthetic process Biological Process

GO:0045723 positive regulation of fatty acid biosynthetic process Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0071365 cellular response to auxin stimulus Biological Process

KEGG gene cross-reference

ath:AT1G34670

ath:AT3G61250

ath:AT4G17785

ath:AT4G21440

ath:AT5G10280

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.805

Rank 1 · LXL04_005447 · OH-1004

Cytoplasm0.332

Rank 2 · LXL04_005447 · OH-1004

Mitochondrion0.037

Rank 3 · LXL04_005447 · OH-1004

Cell membrane0.020

Rank 4 · LXL04_005447 · OH-1004

Endoplasmic reticulum0.012

Rank 5 · LXL04_005447 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249.38Myb_DNA-binding15-62 aa

PF13921.13Myb_DNA-bind_618-76 aa

PF00249.38Myb_DNA-binding68-112 aa

PF13921.13Myb_DNA-bind_671-118 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005447	`PF00249.38`	Myb_DNA-binding	15	62	2.4e-37	127.5
LXL04_005447	`PF13921.13`	Myb_DNA-bind_6	18	76	1.8e-20	73.5
LXL04_005447	`PF00249.38`	Myb_DNA-binding	68	112	2.4e-37	127.5
LXL04_005447	`PF13921.13`	Myb_DNA-bind_6	71	118	1.8e-20	73.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWP0`	Arabidopsis thaliana	Transcription factor MYB39	43.509%	Swiss-Prot	moderate database homology
`Q9S9Z2`	Arabidopsis thaliana	Transcription factor MYB93	65.605%	Swiss-Prot	weak database homology
`Q9M2D9`	Arabidopsis thaliana	Transcription factor MYB17	43.346%	Swiss-Prot	moderate database homology
`Q9SBF3`	Arabidopsis thaliana	Transcription factor MYB92	75.194%	Swiss-Prot	weak database homology
`Q9LDR8`	Arabidopsis thaliana	Transcription factor MYB102	64.024%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card