TkA01G043610 | RubberDandelionOmics

Gene overview

TkA01G043610

Reference: TK1151 Chr: Chr01 Coordinates: 11267974-11268663 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

690 bp · TkA01G043610|TK1151|cDNA

ATGGAGAAACCAACGCCGCCATCACCACCACCAACACCAACACCGTCTACTTCAGTCCTCCGCCGCCTAATTGACTTCGATACTGCTGTTTCCCTTACTCTCTACAACCTTACTCAACCCATCCTCCCCCGCCCCTTCCTCAAACTTCTGGAAATCTCCGGAGACGGCCGCCTCTTCTTCCCAATCCTCCTTTCCCTCCTACTCTCCCCTCTACGATCCGCTTCTCCGCTACTCCTGACCTTACTTGTTAACCTTCTTAT...

CDS

Download CDS FASTA

690 bp · TkA01G043610|TK1151|CDS

ATGGAGAAACCAACGCCGCCATCACCACCACCAACACCAACACCGTCTACTTCAGTCCTCCGCCGCCTAATTGACTTCGATACTGCTGTTTCCCTTACTCTCTACAACCTTACTCAACCCATCCTCCCCCGCCCCTTCCTCAAACTTCTGGAAATCTCCGGAGACGGCCGCCTCTTCTTCCCAATCCTCCTTTCCCTCCTACTCTCCCCTCTACGATCCGCTTCTCCGCTACTCCTGACCTTACTTGTTAACCTTCTTAT...

Protein

Download Protein FASTA

229 aa · TkA01G043610|TK1151|PROTEIN

MEKPTPPSPPPTPTPSTSVLRRLIDFDTAVSLTLYNLTQPILPRPFLKLLEISGDGRLFFPILLSLLLSPLRSASPLLLTLLVNLLIGSLLDLLFIGLIKHLVRRPRPVYNKHMFLTFAVDHWSFPSGHASRVCFTASMFYLSSDLIPSIFLQLKSGISGLDEFETVKRLNMMVIAWAAATSVSRVLLGRHFVFDVAAGAGVGVLNASIVFHILNCEFFRSILSRKLSW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G043610`
TK1151 ID	TkA01G043610
OH-1004 ID	LXL04_005481
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	95.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G043610

Location Chr01:11267974-11268663 (+)

Description Similar to LPPB: Probable lipid phosphate phosphatase beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22550`	Probable lipid phosphate phosphatase beta.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005481 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006695 cholesterol biosynthetic process Biological Process

GO:0006720 isoprenoid metabolic process Biological Process

GO:0018342 protein prenylation Biological Process

GO:0033383 geranyl diphosphate metabolic process Biological Process

GO:0042632 cholesterol homeostasis Biological Process

GO:0045087 innate immune response Biological Process

GO:0045339 farnesyl diphosphate catabolic process Biological Process

GO:0046839 phospholipid dephosphorylation Biological Process

GO:1902247 geranylgeranyl diphosphate catabolic process Biological Process

GO:0005637 nuclear inner membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G22550

dre:553687

hsa:403313

mmu:74411

rno:619549

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.695

Rank 1 · TkA01G043610 · TK1151

Nucleus0.135

Rank 2 · TkA01G043610 · TK1151

Golgi apparatus0.107

Rank 3 · TkA01G043610 · TK1151

Lysosome / Vacuole0.067

Rank 4 · TkA01G043610 · TK1151

Cytoplasm0.067

Rank 5 · TkA01G043610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14378PAP2_364-91 aa

PF01569PAP282-214 aa

PF22778VCPO_2nd120-205 aa

PF14378PAP2_3123-139 aa

PF14378PAP2_3168-205 aa

PF01001HCV_NS4b172-217 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G043610	`PF14378`	PAP2_3	64	91	0.012	16.1
TkA01G043610	`PF01569`	PAP2	82	214	3.1e-17	63.3
TkA01G043610	`PF22778`	VCPO_2nd	120	205	0.012	16.2
TkA01G043610	`PF14378`	PAP2_3	123	139	0.012	16.1
TkA01G043610	`PF14378`	PAP2_3	168	205	0.012	16.1
TkA01G043610	`PF01001`	HCV_NS4b	172	217	0.0027	18.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUW4`	Arabidopsis thaliana	sp\|Q9SUW4\|LPPB_ARATH Probable lipid phosphate phosphatase beta	40.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card