LXL04_005481 | RubberDandelionOmics

Gene overview

LXL04_005481

Reference: OH-1004 Chr: Chr01 Coordinates: 165126249-165126932 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · LXL04_005481|LXL04_005481|OH1004|cDNA

ATGGAGAAACCAACGCCGccatcaccaccaccaacaCCGTCTACTTCAGTCCTCCGCCGCCTAATTGACTTCGATACTACTGTTTCCCTTACTCTCTACAACCTTACTCAACCCATCCTCCCCCGCCCCTTCCTCAAACTTCTGGAAATCTCCGGAGACGGCCGCCTCTTCTTCCCAATCCTCCTTTCCCTCCTACTCTCCCCTCTACGATCCGCTTCTCCGCTACTCCTGACCTTACTTGTTAACCTTCTTATCGGATC...

CDS

Download CDS FASTA

684 bp · LXL04_005481|LXL04_005481|OH1004|CDS

ATGGAGAAACCAACGCCGCCATCACCACCACCAACACCGTCTACTTCAGTCCTCCGCCGCCTAATTGACTTCGATACTACTGTTTCCCTTACTCTCTACAACCTTACTCAACCCATCCTCCCCCGCCCCTTCCTCAAACTTCTGGAAATCTCCGGAGACGGCCGCCTCTTCTTCCCAATCCTCCTTTCCCTCCTACTCTCCCCTCTACGATCCGCTTCTCCGCTACTCCTGACCTTACTTGTTAACCTTCTTATCGGATC...

Protein

Download Protein FASTA

227 aa · LXL04_005481|LXL04_005481|OH1004|PROTEIN

MEKPTPPSPPPTPSTSVLRRLIDFDTTVSLTLYNLTQPILPRPFLKLLEISGDGRLFFPILLSLLLSPLRSASPLLLTLLVNLLIGSLLDLLFIGLIKHLVRRPRPVYNKHMFLTFAVDHWSFPSGHASRVCFTASMFYLSSDFIPSIFLQLKSGILGLDEFETVKRLNMMVIAWAAATSVSRVLLGRHFVFDVAAGAGVGVLNASIVFHILNCEFFRSILSRKLSW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005481`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005481

Location Chr01:165126249-165126932 (-)

Description Similar to LPPB: Probable lipid phosphate phosphatase beta

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g22550`	Probable lipid phosphate phosphatase beta.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005481 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006695 cholesterol biosynthetic process Biological Process

GO:0006720 isoprenoid metabolic process Biological Process

GO:0018342 protein prenylation Biological Process

GO:0033383 geranyl diphosphate metabolic process Biological Process

GO:0042632 cholesterol homeostasis Biological Process

GO:0045087 innate immune response Biological Process

GO:0045339 farnesyl diphosphate catabolic process Biological Process

GO:0046839 phospholipid dephosphorylation Biological Process

GO:1902247 geranylgeranyl diphosphate catabolic process Biological Process

GO:0005637 nuclear inner membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G22550

dre:553687

hsa:403313

mmu:74411

rno:619549

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.726

Rank 1 · LXL04_005481 · OH-1004

Nucleus0.132

Rank 2 · LXL04_005481 · OH-1004

Golgi apparatus0.096

Rank 3 · LXL04_005481 · OH-1004

Cytoplasm0.065

Rank 4 · LXL04_005481 · OH-1004

Lysosome / Vacuole0.059

Rank 5 · LXL04_005481 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01569.28PAP280-212 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005481	`PF01569.28`	PAP2	80	212	3.1e-17	63.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SUW4`	Arabidopsis thaliana	Probable lipid phosphate phosphatase beta	41.089%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card