TkA01G037720 | RubberDandelionOmics

Gene overview

TkA01G037720

Reference: TK1151 Chr: Chr01 Coordinates: 9764875-9766075 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

825 bp · TkA01G037720|TK1151|cDNA

CATTTGTCCAACTAAATAGTCGTCAAAGACTCAAATTTCCCCCCCGTCTCCCCTCACCTTCCTCCCCTTCTTTTCTTATAAAAATAAATAGACAGAGTTTACTCAAGTCATTCCACAAGCTGAATTCTCCTCCTTTTCAATTGAATTCTTCATATCTCCATCAACATGGGTGAAGCCAAGAAAATCGTTGTGAAGGTGGATGTACACGATGATAAACAGAAAAGGAAGGCTATGAAGGCAGTTTCAAAGCTTTCAGGGAT...

CDS

Download CDS FASTA

426 bp · TkA01G037720|TK1151|CDS

ATGGGTGAAGCCAAGAAAATCGTTGTGAAGGTGGATGTACACGATGATAAACAGAAAAGGAAGGCTATGAAGGCAGTTTCAAAGCTTTCAGGGATTGAGTCGTTAGCAATAGACATGAAAGACAAGAAATTGACGGTGATCGGGGATGTTGATCCAGTTTGTATCATCGGAAAACTTAAAAAGCATTGGTACGCTGAGATAGTGACCGTTGGGCCAGCCAAAGAAGAGAAGAAAGATGAAAAGAAGGACGAAAAGAAGGA...

Protein

Download Protein FASTA

141 aa · TkA01G037720|TK1151|PROTEIN

MGEAKKIVVKVDVHDDKQKRKAMKAVSKLSGIESLAIDMKDKKLTVIGDVDPVCIIGKLKKHWYAEIVTVGPAKEEKKDEKKDEKKDDKKDDDKDKKKKEEEENLKKWAAYQYQMCYTPCMTQRYCVQTIEEYPSNSCGIL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G037720`
TK1151 ID	TkA01G037720
OH-1004 ID	LXL04_005519
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	90.200
Protein coverage (%)	TK1151 94.326 / OH-1004 27.310 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G037720

Location Chr01:9764875-9766075 (+)

Description Similar to HIPP39: Heavy metal-associated isoprenylated plant protein 39

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g01490`	Probable heavy-metal-binding protein.	No verified direct reference in this release
`At5g52740`	Probable heavy-metal-binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005519 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G01490

ath:AT5G52740

ath:AT5G52760

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.584

Rank 1 · TkA01G037720 · TK1151

Cell membrane0.342

Rank 2 · TkA01G037720 · TK1151

Nucleus0.335

Rank 3 · TkA01G037720 · TK1151

Extracellular0.060

Rank 4 · TkA01G037720 · TK1151

Mitochondrion0.044

Rank 5 · TkA01G037720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09581Spore_III_AF5-115 aa

PF14851FAM1768-24 aa

PF00403HMA9-64 aa

PF02950Conotoxin14-28 aa

PF12220U1snRNP70_N27-109 aa

PF02724CDC4540-103 aa

PF25789TPR_NAA3563-121 aa

PF21532Bin2_C66-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G037720	`PF09581`	Spore_III_AF	5	115	0.054	14.4
TkA01G037720	`PF14851`	FAM176	8	24	2.2	8.8
TkA01G037720	`PF00403`	HMA	9	64	4.5e-09	37.3
TkA01G037720	`PF02950`	Conotoxin	14	28	2.0	10.1
TkA01G037720	`PF12220`	U1snRNP70_N	27	109	6.7	8.0
TkA01G037720	`PF02724`	CDC45	40	103	0.4	9.6
TkA01G037720	`PF25789`	TPR_NAA35	63	121	1.3	8.5
TkA01G037720	`PF21532`	Bin2_C	66	109	0.28	11.6
TkA01G037720	`PF30881`	At4g14450	72	122	0.081	13.9
TkA01G037720	`PF14851`	FAM176	75	106	2.2	8.8
TkA01G037720	`PF20644`	Rrn7_cyclin_N	76	127	0.15	12.9
TkA01G037720	`PF02950`	Conotoxin	76	126	2.0	10.1
TkA01G037720	`PF00403`	HMA	126	132	4.5e-09	37.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O03982`	Arabidopsis thaliana	sp\|O03982\|HIP39_ARATH Heavy metal-associated isoprenylated plant protein 39	62.700%	Swiss-Prot	Medium
`Q9LTE3`	Arabidopsis thaliana	sp\|Q9LTE3\|HIP12_ARATH Heavy metal-associated isoprenylated plant protein 12	48.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card