TkA01G034190 | RubberDandelionOmics

Gene overview

TkA01G034190

Reference: TK1151 Chr: Chr01 Coordinates: 8889212-8890662 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1164 bp · TkA01G034190|TK1151|cDNA

ATTAACCTCTTTGACCTTTCACCTATAAAACCCCACAAACCCTATCACTTGTCCTCACAAAATTACCACTTACTACCCACTTCCCAACTCTAGAGAGAGAGAAAAAAAGCTTTGAGCTACAATAATGGAGGGCAAGGAAGAAGATGTGAGACTCGGAGCCAACAAGTTTTCAGAAAGGCAGCCGCTCGGAACATCAGCTCAAACGGAATCGAAAGATTACAAGGAGCCACCACCGGCGCCGCTGTTTGAGCCAGGTGAGC...

CDS

Download CDS FASTA

867 bp · TkA01G034190|TK1151|CDS

ATGGAGGGCAAGGAAGAAGATGTGAGACTCGGAGCCAACAAGTTTTCAGAAAGGCAGCCGCTCGGAACATCAGCTCAAACGGAATCGAAAGATTACAAGGAGCCACCACCGGCGCCGCTGTTTGAGCCAGGTGAGCTCTCCTCATGGTCGTTTTACAGAGCCGGAATCGCAGAGTTCATCGCCACCTTCTTGTTCCTGTACATTTCGGTTTTGACCGTCATGGGCGTCGTGAAATCTCCAACGAAATGTGGTACGGTGGG...

Protein

Download Protein FASTA

288 aa · TkA01G034190|TK1151|PROTEIN

MEGKEEDVRLGANKFSERQPLGTSAQTESKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSPTKCGTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMGDAQYTTLGGGANSVAHGYTKGSGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKGHAWDDHWIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G034190`
TK1151 ID	TkA01G034190
OH-1004 ID	LXL04_005566
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G034190

Location Chr01:8889212-8890662 (+)

Description Similar to PIP1.4: Probable aquaporin PIP1-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00430`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At1g01620`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release
`At4g23400`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At3g61430`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005566 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0015670 carbon dioxide transport Biological Process

GO:0080022 primary root development Biological Process

GO:0080147 root hair cell development Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:1902074 response to salt Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

KEGG gene cross-reference

ath:AT2G45960

ath:AT4G00430

mus:104000197

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.796

Rank 1 · TkA01G034190 · TK1151

Cytoplasm0.120

Rank 2 · TkA01G034190 · TK1151

Endoplasmic reticulum0.090

Rank 3 · TkA01G034190 · TK1151

Lysosome / Vacuole0.064

Rank 4 · TkA01G034190 · TK1151

Golgi apparatus0.044

Rank 5 · TkA01G034190 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230MIP45-275 aa

PF12036DUF352248-144 aa

PF12036DUF3522187-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G034190	`PF00230`	MIP	45	275	5.7e-83	278.8
TkA01G034190	`PF12036`	DUF3522	48	144	2.8	8.7
TkA01G034190	`PF12036`	DUF3522	187	247	2.8	8.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39196`	Arabidopsis thaliana	sp\|Q39196\|PIP14_ARATH Probable aquaporin PIP1-4	89.900%	Swiss-Prot	High
`Q08733`	Arabidopsis thaliana	sp\|Q08733\|PIP13_ARATH Aquaporin PIP1-3	90.300%	Swiss-Prot	High
`Q8LAA6`	Arabidopsis thaliana	sp\|Q8LAA6\|PIP15_ARATH Probable aquaporin PIP1-5	88.900%	Swiss-Prot	High
`P61837`	Arabidopsis thaliana	sp\|P61837\|PIP11_ARATH Aquaporin PIP1-1	88.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card