LXL04_005566 | RubberDandelionOmics

Gene overview

LXL04_005566

Reference: OH-1004 Chr: Chr01 Coordinates: 168436420-168437573 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

867 bp · LXL04_005566|LXL04_005566|OH1004|cDNA

ATGGAGGGCAAGGAAGAAGATGTGAGACTCGGAGCCAACAAGTTTTCAGAAAGGCAGCCGCTCGGAACATCAGCTCAAACGGAATCGAAAGATTACAAGGAGCCACCACCGGCGCCGCTGTTTGAGCCAGGTGAGCTCTCCTCATGGTCGTTTTACAGAGCCGGAATCGCAGAGTTCATCGCCACCTTCTTGTTCCTGTACATTTCGGTTTTGACCGTCATGGGCGTCGTGAAATCTCCAACGAAATGTGGTACGGTGGG...

CDS

Download CDS FASTA

867 bp · LXL04_005566|LXL04_005566|OH1004|CDS

ATGGAGGGCAAGGAAGAAGATGTGAGACTCGGAGCCAACAAGTTTTCAGAAAGGCAGCCGCTCGGAACATCAGCTCAAACGGAATCGAAAGATTACAAGGAGCCACCACCGGCGCCGCTGTTTGAGCCAGGTGAGCTCTCCTCATGGTCGTTTTACAGAGCCGGAATCGCAGAGTTCATCGCCACCTTCTTGTTCCTGTACATTTCGGTTTTGACCGTCATGGGCGTCGTGAAATCTCCAACGAAATGTGGTACGGTGGG...

Protein

Download Protein FASTA

288 aa · LXL04_005566|LXL04_005566|OH1004|PROTEIN

MEGKEEDVRLGANKFSERQPLGTSAQTESKDYKEPPPAPLFEPGELSSWSFYRAGIAEFIATFLFLYISVLTVMGVVKSPTKCGTVGIQGIAWAFGGMIFALVYCTAGISGGHINPAVTFGLLLARKLSLTRAVFYMVMQCLGAICGAGVVKGFMGDAQYTTLGGGANSVAHGYTKGSGLGAEIVGTFVLVYTVFSATDAKRSARDSHVPILAPLPIGFAVFLVHLATIPITGTGINPARSLGAAIIYNKGHAWDDHWIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005566`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005566

Location Chr01:168436420-168437573 (-)

Description Similar to PIP1.4: Probable aquaporin PIP1-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g00430`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release
`At2g45960`	Water channel required to facilitate the transport of water across cell membrane.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0559700`	Aquaporins facilitate the transport of water and small neutral solutes across cell membranes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005566 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006833 water transport Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0015670 carbon dioxide transport Biological Process

GO:0080022 primary root development Biological Process

GO:0080147 root hair cell development Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:1902074 response to salt Biological Process

GO:2000070 regulation of response to water deprivation Biological Process

KEGG gene cross-reference

ath:AT2G45960

ath:AT4G00430

mus:104000197

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.796

Rank 1 · LXL04_005566 · OH-1004

Cytoplasm0.120

Rank 2 · LXL04_005566 · OH-1004

Endoplasmic reticulum0.090

Rank 3 · LXL04_005566 · OH-1004

Lysosome / Vacuole0.064

Rank 4 · LXL04_005566 · OH-1004

Golgi apparatus0.044

Rank 5 · LXL04_005566 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00230.26MIP45-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005566	`PF00230.26`	MIP	45	275	5.7e-83	278.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q39196`	Arabidopsis thaliana	Probable aquaporin PIP1-4	89.931%	Swiss-Prot	strong database homology
`Q06611`	Arabidopsis thaliana	Aquaporin PIP1-2	88.542%	Swiss-Prot	strong database homology
`Q7XSQ9`	Oryza sativa subsp. japonica	Probable aquaporin PIP1-2	88.581%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card