TkA01G032330 | RubberDandelionOmics

Gene overview

TkA01G032330

Reference: TK1151 Chr: Chr01 Coordinates: 8372698-8375329 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1775 bp · TkA01G032330|TK1151|cDNA

GATTCCATTCTCCCCTTCTTGCCCGTTATTACTTGATTTGAATTTCAAATAGAAAAAGACAAAAAAACCACCCTCTTGGCCTCTTTCTTCTACTCCCAAGAAACTCACAACCACTTCAATTCCCAAATCTCGTTTCTCTGGTTCTTCGGAGTTTCAAGAAACCCATAAACCCACTTCCGTTTCTCTCTCGTTTCAAGATTTTTGATAGTTTTATTGTCTCCTTGAAGGTTTGATCGTTTAATGGGTGCTTCAGGAAAATG...

CDS

Download CDS FASTA

1305 bp · TkA01G032330|TK1151|CDS

ATGGGTGCTTCAGGAAAATGGATGAAAGCTCTCATACTCAAGAAATCAGAAAAAGTTGACCAGGATAAATCCGTGAAAAGCGGCAAGAAGTGGAAGCTATTTAGGAGCTCATCGGGGGAGATGAGTGTTGGTTGGAAAGGATTTAAAGGAAGCTACAGGGGAGGAGCAGCATCTGCATCTGATGGATCAGATGCATCCTCTGTTATTAGCTCCGATCCTTTCTCCGCCGCTGTCGCCACCGTTGTTCGAGCTCAGCCGAA...

Protein

Download Protein FASTA

434 aa · TkA01G032330|TK1151|PROTEIN

MGASGKWMKALILKKSEKVDQDKSVKSGKKWKLFRSSSGEMSVGWKGFKGSYRGGAASASDGSDASSVISSDPFSAAVATVVRAQPKDFKAVRQEWAAIRIQTAFRGFLARRALRALKGVVRIQALVRGRQVRKQAAVTLRCMQALVRVQARVRARRVRMSIEGQAVQNMLNERRTQAELLKEAEEGWCDHRGTLQEIKAKIQMRQEGAFKRERALAYGLAQKQWKSNQGVGSKNRASLTSLKNQQFDKSSWGWSWLERW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G032330`
TK1151 ID	TkA01G032330
OH-1004 ID	LXL04_005582
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 83.301 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G032330

Location Chr01:8372698-8375329 (-)

Description Similar to IQD1: Protein IQ-DOMAIN 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26180`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g72670`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g17480`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g22190`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	The Microtubule-Associated Protein IQ67 DOMAIN5 Modulates Microtubule Dynamics and Pavement Cell Shape.2018 · DOI: 10.1104/pp.18.00558 Microtubule-associated protein IQ67 DOMAIN5 regulates morphogenesis of leaf pavement cells in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery395
`At5g03040`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005582 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0051211 anisotropic cell growth Biological Process

GO:0070507 regulation of microtubule cytoskeleton organization Biological Process

GO:0072699 protein localization to cortical microtubule cytoskeleton Biological Process

GO:0090436 leaf pavement cell development Biological Process

GO:2001006 regulation of cellulose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005876 spindle microtubule Cellular Component

KEGG gene cross-reference

ath:AT1G17480

ath:AT1G72670

ath:AT2G26180

ath:AT3G22190

ath:AT5G03040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.447

Rank 1 · TkA01G032330 · TK1151

Cell membrane0.361

Rank 2 · TkA01G032330 · TK1151

Nucleus0.347

Rank 3 · TkA01G032330 · TK1151

Endoplasmic reticulum0.045

Rank 4 · TkA01G032330 · TK1151

Plastid0.036

Rank 5 · TkA01G032330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00612IQ96-115 aa

PF00612IQ118-135 aa

PF00612IQ145-159 aa

PF13178DUF4005233-241 aa

PF13178DUF4005339-379 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G032330	`PF00612`	IQ	96	115	7.9e-06	25.9
TkA01G032330	`PF00612`	IQ	118	135	7.9e-06	25.9
TkA01G032330	`PF00612`	IQ	145	159	7.9e-06	25.9
TkA01G032330	`PF13178`	DUF4005	233	241	0.0018	19.5
TkA01G032330	`PF13178`	DUF4005	339	379	0.0018	19.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64852`	Arabidopsis thaliana	sp\|O64852\|IQD6_ARATH Protein IQ-DOMAIN 6	62.000%	Swiss-Prot	High
`Q9CAI2`	Arabidopsis thaliana	sp\|Q9CAI2\|IQD8_ARATH Protein IQ-DOMAIN 8	45.600%	Swiss-Prot	Medium
`Q2NND9`	Arabidopsis thaliana	sp\|Q2NND9\|IQD7_ARATH Protein IQ-DOMAIN 7	37.100%	Swiss-Prot	Medium
`F4J061`	Arabidopsis thaliana	sp\|F4J061\|IQD5_ARATH Protein IQ-DOMAIN 5	42.000%	Swiss-Prot	Medium
`Q93ZH7`	Arabidopsis thaliana	sp\|Q93ZH7\|IQD2_ARATH Protein IQ-DOMAIN 2	35.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card