LXL04_005582 | RubberDandelionOmics

Gene overview

LXL04_005582

Reference: OH-1004 Chr: Chr01 Coordinates: 168787310-168790721 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1566 bp · LXL04_005582|LXL04_005582|OH1004|cDNA

ATGCATAAAGTACAAGGCAAAACTGATCAAAGCAGGTGGGACCCAGCTTTTTTCTTCTTGGCTCGACGCTACAGCTTTGGCGAGGCAGCCTTGGCGCTGGAGCTTGGCGAAGGTGGAGGGCTGGTGTTGGCGCGCGTCAAGGCCCTTGGCGAACCACCTTGGCGCCGACACACCCCGTGGTCTAATGGTTTTGCTTACAACATACTCCTGTTTCGAGCAGACGAAAACGAGATTGTGGTCAACCGCAGGTTTGATCGTTT...

CDS

Download CDS FASTA

1566 bp · LXL04_005582|LXL04_005582|OH1004|CDS

ATGCATAAAGTACAAGGCAAAACTGATCAAAGCAGGTGGGACCCAGCTTTTTTCTTCTTGGCTCGACGCTACAGCTTTGGCGAGGCAGCCTTGGCGCTGGAGCTTGGCGAAGGTGGAGGGCTGGTGTTGGCGCGCGTCAAGGCCCTTGGCGAACCACCTTGGCGCCGACACACCCCGTGGTCTAATGGTTTTGCTTACAACATACTCCTGTTTCGAGCAGACGAAAACGAGATTGTGGTCAACCGCAGGTTTGATCGTTT...

Protein

Download Protein FASTA

521 aa · LXL04_005582|LXL04_005582|OH1004|PROTEIN

MHKVQGKTDQSRWDPAFFFLARRYSFGEAALALELGEGGGLVLARVKALGEPPWRRHTPWSNGFAYNILLFRADENEIVVNRRFDRLMGASGKWMKALILKKSEKVDQDKSVKSGKKWKLFRSSSGEMSVGWKGFKGSYRGGAASASDGSDASSVISSDPFSAAVATVVRAQPKDFKAVRQEWAAIRIQTAFRGFLARRALRALKGVVRIQALVRGRQVRKQAAVTLRCMQALVRVQARVRARRVRMSIEGQAVQNMLNE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005582`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005582

Location Chr01:168787310-168790721 (+)

Description Similar to IQD1: Protein IQ-DOMAIN 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g26180`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g72670`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At1g17480`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release
`At3g22190`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	The Microtubule-Associated Protein IQ67 DOMAIN5 Modulates Microtubule Dynamics and Pavement Cell Shape.2018 · DOI: 10.1104/pp.18.00558 Microtubule-associated protein IQ67 DOMAIN5 regulates morphogenesis of leaf pavement cells in Arabidopsis thaliana.2019 · DOI: 10.1093/jxb/ery395
`At5g03040`	May be involved in cooperative interactions with calmodulins or calmodulin-like proteins (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005582 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007017 microtubule-based process Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0051211 anisotropic cell growth Biological Process

GO:0070507 regulation of microtubule cytoskeleton organization Biological Process

GO:0072699 protein localization to cortical microtubule cytoskeleton Biological Process

GO:0090436 leaf pavement cell development Biological Process

GO:2001006 regulation of cellulose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0005876 spindle microtubule Cellular Component

KEGG gene cross-reference

ath:AT1G17480

ath:AT1G72670

ath:AT2G26180

ath:AT3G22190

ath:AT5G03040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.413

Rank 1 · LXL04_005582 · OH-1004

Cell membrane0.367

Rank 2 · LXL04_005582 · OH-1004

Nucleus0.348

Rank 3 · LXL04_005582 · OH-1004

Endoplasmic reticulum0.057

Rank 4 · LXL04_005582 · OH-1004

Plastid0.047

Rank 5 · LXL04_005582 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64852`	Arabidopsis thaliana	Protein IQ-DOMAIN 6	59.767%	Swiss-Prot	strong database homology
`Q9CAI2`	Arabidopsis thaliana	Protein IQ-DOMAIN 8	49.868%	Swiss-Prot	moderate database homology
`Q2NND9`	Arabidopsis thaliana	Protein IQ-DOMAIN 7	37.321%	Swiss-Prot	moderate database homology
`F4J061`	Arabidopsis thaliana	Protein IQ-DOMAIN 5	41.139%	Swiss-Prot	moderate database homology
`Q93ZH7`	Arabidopsis thaliana	Protein IQ-DOMAIN 2	41.071%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card