TkA01G031690 | RubberDandelionOmics

Gene overview

TkA01G031690

Reference: TK1151 Chr: Chr01 Coordinates: 8185582-8188474 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1826 bp · TkA01G031690|TK1151|cDNA

CGGGTGTCGACACACCCTCTCTCTAACCCTCAAAAAAATTCTGTATTCTTTCCACCCCCAAGCCACCGAATCTCTACCATTAACGAAACTATGTCGACATTTTCCTCTCTTTTGATCACACTTTCCACAGCCGTCTGCAATATAAATTGTCAAATTGTGCGCTGGATACGAGAGAGTGGCGTAGTTATCGTACTCGAAGCAAACCGATTCGACACGAACCTAGGATCTTTAGGGATCCGTGCCCCCTTTTTGGTATCGAT...

CDS

Download CDS FASTA

1242 bp · TkA01G031690|TK1151|CDS

ATGTCAGTGCTAGAGGAACTCTTCCCTCTGCTTTATTCAGAGGAATTTGGAGGAAAGTTTGGGACGTTACAAGGCTCACTTCTCAGGAATCTTTCAAACTCAATGTCCACCGATAGTTGCAGCGACTTACCGGAGCTTGACTCCTGCCGGGATGAAAAAGCCGCCCTCATCCTCAAATTCGTGGCCATGGCTTCCATTCTTCTCGCCGGAATATTTGGAGTCGCTATCCCATTAATCGGCAAGAAACGGAAGTTTCTCAG...

Protein

Download Protein FASTA

413 aa · TkA01G031690|TK1151|PROTEIN

MSVLEELFPLLYSEEFGGKFGTLQGSLLRNLSNSMSTDSCSDLPELDSCRDEKAALILKFVAMASILLAGIFGVAIPLIGKKRKFLRTDTNLFFAAKAFAAGVILATGFVHMLPDATSALSNRCLPKNPWSKFPFSGFIAMMAALGTLVADFLSTQYYERKHEKQVQAVRVDSVDLAADSENGIVPVAGKDDHHGKEDGSDIHIVGMHAHVAQHRHNHASGQEGCEGQNSHFSDVESPSNIHSHSHGFDDDDNSIRHVVV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G031690`
TK1151 ID	TkA01G031690
OH-1004 ID	LXL04_025198
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	41.400
Protein coverage (%)	TK1151 88.378 / OH-1004 90.517 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G031690

Location Chr01:8185582-8188474 (-)

Description Similar to ZIP10: Probable zinc transporter 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g60960`	May play a role in the transport of iron in the plastids.	No verified direct reference in this release
`At1g10970`	May play a role in the transport of zinc in the plastids.	No verified direct reference in this release
`At4g33020`	Zinc transporter involved in zinc uptake in roots.	Identification of putative target genes of bZIP19, a transcription factor essential for Arabidopsis adaptation to Zn deficiency in roots.2015 · DOI: 10.1111/tpj.12996

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0566300`	Zinc transporter that may be involved in zinc uptake from the rhizosphere.	No verified direct reference in this release
`Os05g0198400`	Zinc transporter that may be involved in zinc uptake from the rhizosphere.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025198 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006826 iron ion transport Biological Process

GO:0006828 manganese ion transport Biological Process

GO:0006829 zinc ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0009617 response to bacterium Biological Process

GO:0015675 nickel cation transport Biological Process

GO:0015691 cadmium ion transport Biological Process

GO:0030001 metal ion transport Biological Process

GO:0071577 zinc ion transmembrane transport Biological Process

GO:0005768 endosome Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G31260

ath:AT4G19680

ath:AT4G19690

dosa:Os03g0667500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.721

Rank 1 · TkA01G031690 · TK1151

Lysosome / Vacuole0.108

Rank 2 · TkA01G031690 · TK1151

Endoplasmic reticulum0.107

Rank 3 · TkA01G031690 · TK1151

Cytoplasm0.075

Rank 4 · TkA01G031690 · TK1151

Golgi apparatus0.044

Rank 5 · TkA01G031690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02535Zip57-410 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G031690	`PF02535`	Zip	57	410	2.8e-82	277.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LE59`	Arabidopsis thaliana	sp\|Q8LE59\|IRT3_ARATH Fe(2+) transport protein 3, chloroplastic	59.200%	Swiss-Prot	High
`O04089`	Arabidopsis thaliana	sp\|O04089\|ZIP4_ARATH Zinc transporter 4, chloroplastic	63.300%	Swiss-Prot	High
`O82643`	Arabidopsis thaliana	sp\|O82643\|ZIP9_ARATH Zinc transporter 9	55.300%	Swiss-Prot	High
`Q5Z653`	Oryza sativa subsp. japonica	sp\|Q5Z653\|ZIP10_ORYSJ Zinc transporter 10	56.500%	Swiss-Prot	High
`Q6L8F7`	Oryza sativa subsp. japonica	sp\|Q6L8F7\|ZIP7_ORYSJ Zinc transporter 7	54.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card