LXL04_025198 | RubberDandelionOmics

Gene overview

LXL04_025198

Reference: OH-1004 Chr: Chr05 Coordinates: 107438916-107440199 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1047 bp · LXL04_025198|LXL04_025198|OH1004|cDNA

ATGGCTTCCACTTCTAAAATGGTCTCAattttcatcatcttcatcGCATTTCTATGCACCAAAGCCATGTCACAATGTGAAGACGAAACAAATAACCCTTGTAACAACAAATCCAAGGCTTTATCCTTAAAGATCATCGGGATCGCTGCCATCCTTGTCACAAGTATCATCGGCGTATGTCTACCTCTCATCACTCGTTCAATCCCCGCACTTAGCCCAGAACGTAGCCTTTTTGTGATTGTGAAAGCTTTCGCTTCCGG...

CDS

Download CDS FASTA

1047 bp · LXL04_025198|LXL04_025198|OH1004|CDS

ATGGCTTCCACTTCTAAAATGGTCTCAATTTTCATCATCTTCATCGCATTTCTATGCACCAAAGCCATGTCACAATGTGAAGACGAAACAAATAACCCTTGTAACAACAAATCCAAGGCTTTATCCTTAAAGATCATCGGGATCGCTGCCATCCTTGTCACAAGTATCATCGGCGTATGTCTACCTCTCATCACTCGTTCAATCCCCGCACTTAGCCCAGAACGTAGCCTTTTTGTGATTGTGAAAGCTTTCGCTTCCGG...

Protein

Download Protein FASTA

348 aa · LXL04_025198|LXL04_025198|OH1004|PROTEIN

MASTSKMVSIFIIFIAFLCTKAMSQCEDETNNPCNNKSKALSLKIIGIAAILVTSIIGVCLPLITRSIPALSPERSLFVIVKAFASGIILATGFMHVLPDSFDMLSSSCLSDNPWHKFPFTGFVAMLSAIFTLMVDSMATSMYTTKNNAISSEGVAPVTGDHEMAAGGGGGMHFHGHHHGQKAPIGAQLLRYRVVAMVLELGIVVHSIVIGLGVGASNDVCTIKPLVAALCFHQMFEGMGLGGCILQAEYKMMKKAIMVF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_025198`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_025198

Location Chr05:107438916-107440199 (-)

Description Similar to ZIP10: Probable zinc transporter 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31260`	Probably mediates zinc uptake from the rhizosphere.	No verified direct reference in this release
`At4g19690`	High-affinity iron transporter that plays a key role in the uptake of iron from the rhizosphere across the plasma membrane in the root epidermal layer.	IRT1, an Arabidopsis transporter essential for iron uptake from the soil and for plant growth.2002 · DOI: 10.1105/tpc.001388
`At5g45105`	Probably mediates zinc uptake from the rhizosphere.	No verified direct reference in this release
`At4g19680`	High-affinity iron transporter that mediates under iron- deficiency the iron uptake from the rhizosphere across the plasma membrane in the root epidermal layer.	Arabidopsis IRT2 gene encodes a root-periphery iron transporter.2001 · DOI: 10.1046/j.1365-313x.2001.01018.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0667500`	Iron transporter involved in the uptake of iron from the rhizosphere across the plasma membrane in the root epidermal layer.	Rice plants take up iron as an Fe3+-phytosiderophore and as Fe2+.2006 · DOI: 10.1111/j.1365-313x.2005.02624.x Over-expression of OsIRT1 leads to increased iron and zinc accumulations in rice.2009 · DOI: 10.1111/j.1365-3040.2009.01935.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025198 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006826 iron ion transport Biological Process

GO:0006828 manganese ion transport Biological Process

GO:0006829 zinc ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0009617 response to bacterium Biological Process

GO:0015675 nickel cation transport Biological Process

GO:0015691 cadmium ion transport Biological Process

GO:0030001 metal ion transport Biological Process

GO:0071577 zinc ion transmembrane transport Biological Process

GO:0005768 endosome Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT1G31260

ath:AT4G19680

ath:AT4G19690

dosa:Os03g0667500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.797

Rank 1 · LXL04_025198 · OH-1004

Endoplasmic reticulum0.081

Rank 2 · LXL04_025198 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_025198 · OH-1004

Lysosome / Vacuole0.067

Rank 4 · LXL04_025198 · OH-1004

Golgi apparatus0.035

Rank 5 · LXL04_025198 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02535.29Zip42-345 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_025198	`PF02535.29`	Zip	42	345	1.3e-81	275.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W245`	Arabidopsis thaliana	Probable zinc transporter 10	65.789%	Swiss-Prot	strong database homology
`Q38856`	Arabidopsis thaliana	Fe(2+) transport protein 1	60.674%	Swiss-Prot	strong database homology
`Q8S3W4`	Arabidopsis thaliana	Probable zinc transporter 8	60.674%	Swiss-Prot	strong database homology
`O81850`	Arabidopsis thaliana	Fe(2+) transport protein 2	58.873%	Swiss-Prot	strong database homology
`Q75HB1`	Oryza sativa subsp. japonica	Fe(2+) transport protein 1	59.443%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card