TkA01G030070 | RubberDandelionOmics

Gene overview

TkA01G030070

Reference: TK1151 Chr: Chr01 Coordinates: 7700642-7702720 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1100 bp · TkA01G030070|TK1151|cDNA

GAATGCTTTACCATAGAAAGTGTCAACCATGGGGTCATCTGGCCATAAACATGATGGTATGGAAAAGTTAGCAACAAGAAGGTTGATGGGGAAAATTGCAATTGTAACAGGTGGAGCAAGGGGTATCGGAGCTGCAACAGCTACATTAATGGCTGAGAACGGCGCTTATGTTATTGTTGCGGATATTTTAAACGATATTGGTGAAAGTCTTGCGAAGTCTATTGGAGGTCTTTACATACACTGTGATGTCTCTAATGAAT...

CDS

Download CDS FASTA

861 bp · TkA01G030070|TK1151|CDS

ATGGGGTCATCTGGCCATAAACATGATGGTATGGAAAAGTTAGCAACAAGAAGGTTGATGGGGAAAATTGCAATTGTAACAGGTGGAGCAAGGGGTATCGGAGCTGCAACAGCTACATTAATGGCTGAGAACGGCGCTTATGTTATTGTTGCGGATATTTTAAACGATATTGGTGAAAGTCTTGCGAAGTCTATTGGAGGTCTTTACATACACTGTGATGTCTCTAATGAATCCGACGTCGAATCTGCCGTTCAACTTGC...

Protein

Download Protein FASTA

286 aa · TkA01G030070|TK1151|PROTEIN

MGSSGHKHDGMEKLATRRLMGKIAIVTGGARGIGAATATLMAENGAYVIVADILNDIGESLAKSIGGLYIHCDVSNESDVESAVQLALSWKGRLDIFFNNAGITDNGRSITNLEMEKVTNIINVNVKGVIHGIKHAARGMISAGNGGSIICSSSSAALMGGLASHAYTVTKGAILAISKSAACELGVHSIRVNCVSPHAIPSEMLVRAYQEYLGKPDMTTEEVSNRICKGGSLLDGRCGSVDDVAQAVLFLASDEAGFVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G030070`
TK1151 ID	TkA01G030070
OH-1004 ID	LXL04_010307
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.700
Protein coverage (%)	TK1151 88.811 / OH-1004 56.036 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G030070

Location Chr01:7700642-7702720 (+)

Description Similar to Secoisolariciresinol dehydrogenase (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g42960`	May play a role in tapetum development.	No verified direct reference in this release
`At3g51680`	Short-chain dehydrogenase reductase 2a.	No verified direct reference in this release
`At2g47140`	Short-chain dehydrogenase reductase 3b.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010307 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009807 lignan biosynthetic process Biological Process

GO:0016099 monoterpenoid biosynthetic process Biological Process

GO:0044283 small molecule biosynthetic process Biological Process

GO:0046211 (+)-camphor biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0010301 xanthoxin dehydrogenase (NAD+) activity Molecular Function

GO:0016491 oxidoreductase activity Molecular Function

GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Molecular Function

GO:0047500 (+)-borneol dehydrogenase activity Molecular Function

KEGG gene cross-reference

ag:BAK09296

ath:AT3G51680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.630

Rank 1 · TkA01G030070 · TK1151

Nucleus0.277

Rank 2 · TkA01G030070 · TK1151

Peroxisome0.215

Rank 3 · TkA01G030070 · TK1151

Mitochondrion0.089

Rank 4 · TkA01G030070 · TK1151

Plastid0.045

Rank 5 · TkA01G030070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00106adh_short22-208 aa

PF08659KR25-179 aa

PF01370Epimerase25-112 aa

PF13561adh_short_C229-271 aa

PF00364Biotin_lipoyl106-144 aa

PF01370Epimerase241-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G030070	`PF00106`	adh_short	22	208	3.5e-41	141.6
TkA01G030070	`PF08659`	KR	25	179	1.1e-07	32.7
TkA01G030070	`PF01370`	Epimerase	25	112	0.084	13.0
TkA01G030070	`PF13561`	adh_short_C2	29	271	3.8e-55	187.8
TkA01G030070	`PF00364`	Biotin_lipoyl	106	144	0.065	13.8
TkA01G030070	`PF01370`	Epimerase	241	256	0.084	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1K9`	Arabidopsis thaliana	sp\|Q9M1K9\|ATA1_ARATH Short-chain dehydrogenase reductase ATA1	60.200%	Swiss-Prot	High
`Q9SCU0`	Arabidopsis thaliana	sp\|Q9SCU0\|SDR2A_ARATH Short-chain dehydrogenase reductase 2a	45.800%	Swiss-Prot	Medium
`Q94K41`	Arabidopsis thaliana	sp\|Q94K41\|SDR3B_ARATH Short-chain dehydrogenase reductase 3b	40.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card