TkA01G024060 | RubberDandelionOmics

Gene overview

TkA01G024060

Reference: TK1151 Chr: Chr01 Coordinates: 6203175-6207959 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1085 bp · TkA01G024060|TK1151|cDNA

TCTGATTCCATTTTCTGCAAACCCTATCAAAACCGTATACATTCCCACAATCCAAAACAATCGCGAGAAGGAAGCCTCGTTTCCGTATCGGATTATGAAAACTTTCATCATCGTTCTCTTCTCTTCTTCCTTTTCATCCATCGATATTTCAAATCAATTCACCCCTACCACACCGTTTTTTCTTCAACAAACTTTAATGAAATGTTGAAGATTTGGCGATGGTATCAAACCTGTTTAGCTATTCATCCGGTGAAAACGCA...

CDS

Download CDS FASTA

1395 bp · TkA01G024060|TK1151|CDS

ATGGCGGAGCTAATACTAATTCGTAACCAGCTTTTCCCCAAACCCTTATCTTTTTCATCATCATCTAAAGTTACGCCTATGATACTTAATCGCCAACCCTTCAAATTCAGCAATAACCATCAATCACTTTCTCGAAGTTTCGGGAGCTTCAACCGCCCCCTTCTCGTTCATCGGATTCCTCGATCTCATCTACTGTGCAAAATGAAAGACTCCGATATGATATCGCAGCTGGAGGTTGGAAAAGACATCGACAAAAGAAA...

Protein

Download Protein FASTA

464 aa · TkA01G024060|TK1151|PROTEIN

MAELILIRNQLFPKPLSFSSSSKVTPMILNRQPFKFSNNHQSLSRSFGSFNRPLLVHRIPRSHLLCKMKDSDMISQLEVGKDIDKRKSDKQVNGIFWILLLNIGIFVADHIFQVREIKSLYLYHNFPVWYQFVTSTFCHADWNHLSSNLFFLYIFGKLVEEEEGNFGLWLSYILTGAGANLVSWLILPRNAVSVGASGAVFGLFAISVLVKLSFDWRKILEVLILGQFVIERVMEAAQASTSFASSSSAIQNVNHIAHLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G024060`
TK1151 ID	TkA01G024060
OH-1004 ID	LXL04_005674
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G024060

Location Chr01:6203175-6207959 (-)

Description Similar to RBL11: Rhomboid-like protein 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25752`	Rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005674 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:0080140 regulation of jasmonic acid metabolic process Biological Process

GO:1901858 regulation of mitochondrial DNA metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

KEGG gene cross-reference

ddi:DDB_G0290631

hsa:4358

rno:360463

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.968

Rank 1 · TkA01G024060 · TK1151

Mitochondrion0.032

Rank 2 · TkA01G024060 · TK1151

Nucleus0.026

Rank 3 · TkA01G024060 · TK1151

Cytoplasm0.025

Rank 4 · TkA01G024060 · TK1151

Peroxisome0.020

Rank 5 · TkA01G024060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08551DUF1751116-187 aa

PF01694Rhomboid129-269 aa

PF04117Mpv17_PMP22377-437 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G024060	`PF08551`	DUF1751	116	187	0.018	15.1
TkA01G024060	`PF01694`	Rhomboid	129	269	1.2e-25	91.1
TkA01G024060	`PF04117`	Mpv17_PMP22	377	437	1.3e-19	70.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84MB5`	Arabidopsis thaliana	sp\|Q84MB5\|RBL11_ARATH Rhomboid-like protein 11, chloroplastic	74.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card