LXL04_005674 | RubberDandelionOmics

Gene overview

LXL04_005674

Reference: OH-1004 Chr: Chr01 Coordinates: 170771594-170775406 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1470 bp · LXL04_005674|LXL04_005674|OH1004|cDNA

ATGGCGGAGCTAATACTAATTCGTAACCAGCTTTTCCCCAAACCCTTATCTTTTCCATCATCATCTAAAGTTACGCCTATGATACTTAATCGCCAACCCTTCAAATTCAGCAATAATCATCAATCACTTTCTCGAAGTTTCGGGAGCTTCAACCTCCCCCTTCTCGTTCATCGGATTCCTCGATCTCATCTACTGTGCAAAATGAAAGACTCCGATATGATATCGCAGCTGGAGGTTGGAAAAGACATCGACAAAAGAAA...

CDS

Download CDS FASTA

1470 bp · LXL04_005674|LXL04_005674|OH1004|CDS

ATGGCGGAGCTAATACTAATTCGTAACCAGCTTTTCCCCAAACCCTTATCTTTTCCATCATCATCTAAAGTTACGCCTATGATACTTAATCGCCAACCCTTCAAATTCAGCAATAATCATCAATCACTTTCTCGAAGTTTCGGGAGCTTCAACCTCCCCCTTCTCGTTCATCGGATTCCTCGATCTCATCTACTGTGCAAAATGAAAGACTCCGATATGATATCGCAGCTGGAGGTTGGAAAAGACATCGACAAAAGAAA...

Protein

Download Protein FASTA

489 aa · LXL04_005674|LXL04_005674|OH1004|PROTEIN

MAELILIRNQLFPKPLSFPSSSKVTPMILNRQPFKFSNNHQSLSRSFGSFNLPLLVHRIPRSHLLCKMKDSDMISQLEVGKDIDKRKSDKQVNGIFWILLLNIGIFVADHIFQVREIKSLYLYHNFPVWYQFVTSTFCHADWNHLSSNLFFLYIFGKLVEEEEGNFGLWLSYILTGAGANLVSWLILPRNAVSVGASGAVFGLFAISVLVKLSFDWRKILEVLILGQFVIERVMEAAQASTSFASSSSAIQNVNHIAHLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005674`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005674

Location Chr01:170771594-170775406 (+)

Description Similar to RBL11: Rhomboid-like protein 11, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25752`	Rhomboid-type serine protease that catalyzes intramembrane proteolysis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005674 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0072593 reactive oxygen species metabolic process Biological Process

GO:0080140 regulation of jasmonic acid metabolic process Biological Process

GO:1901858 regulation of mitochondrial DNA metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

KEGG gene cross-reference

ddi:DDB_G0290631

hsa:4358

rno:360463

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.961

Rank 1 · LXL04_005674 · OH-1004

Mitochondrion0.037

Rank 2 · LXL04_005674 · OH-1004

Nucleus0.028

Rank 3 · LXL04_005674 · OH-1004

Cytoplasm0.027

Rank 4 · LXL04_005674 · OH-1004

Peroxisome0.020

Rank 5 · LXL04_005674 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01694.29Rhomboid129-271 aa

PF04117.18Mpv17_PMP22402-462 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005674	`PF01694.29`	Rhomboid	129	271	2.7e-26	93.2
LXL04_005674	`PF04117.18`	Mpv17_PMP22	402	462	1.4e-19	70.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84MB5`	Arabidopsis thaliana	Rhomboid-like protein 11, chloroplastic	74.879%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card