TkA01G019920 | RubberDandelionOmics

Gene overview

TkA01G019920

Reference: TK1151 Chr: Chr01 Coordinates: 5110781-5116568 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1509 bp · TkA01G019920|TK1151|cDNA

ATGGTTGATCAAAGAAAGGGGCTGCACATGGTTGATCTGTTGGAGGCTGGAAACAACATTTTTGTTTACAGTGCAAATTTTATCACATGGGCGGGATGGAAACCGAGAGTTACTATTATGGACCCTGAGTTAATCAAAGAAGTATTTGCCAAGTCCAATGACTTTAAAAAGTTGAAACCTACTCTAGTAACTAAGTTCATAGCAACAGGCTTACTGACATACGAAGGGGATCAATGGGCTAAACATAGGAAATTAATCAA...

CDS

Download CDS FASTA

1509 bp · TkA01G019920|TK1151|CDS

ATGGTTGATCAAAGAAAGGGGCTGCACATGGTTGATCTGTTGGAGGCTGGAAACAACATTTTTGTTTACAGTGCAAATTTTATCACATGGGCGGGATGGAAACCGAGAGTTACTATTATGGACCCTGAGTTAATCAAAGAAGTATTTGCCAAGTCCAATGACTTTAAAAAGTTGAAACCTACTCTAGTAACTAAGTTCATAGCAACAGGCTTACTGACATACGAAGGGGATCAATGGGCTAAACATAGGAAATTAATCAA...

Protein

Download Protein FASTA

502 aa · TkA01G019920|TK1151|PROTEIN

MVDQRKGLHMVDLLEAGNNIFVYSANFITWAGWKPRVTIMDPELIKEVFAKSNDFKKLKPTLVTKFIATGLLTYEGDQWAKHRKLINPAFHMEKLKNMIPTFQLSGNKMLGKWEKLVSSKGSCELDIWPDLQALTRKNTLTKVPGSVPNYYNLIVQLPFTTSIEMRLHNCNTKGFAWNIHSEEERVGRIEDAHQLLDEMLERTVMKLTRNMRLSVHTSNLEDINTFGNWLLDIGEGKVGGLNDSEAIIDIPDDLLINDSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G019920`
TK1151 ID	TkA01G019920
OH-1004 ID	LXL04_027590
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.200
Protein coverage (%)	TK1151 72.112 / OH-1004 97.534 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G019920

Location Chr01:5110781-5116568 (-)

Description Similar to Pif1: ATP-dependent DNA helicase PIF1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g14690`	Cytochrome P450 72A15.	No verified direct reference in this release
`At3g14680`	Cytochrome P450 72A14.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027590 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000723 telomere maintenance Biological Process

GO:0001117 protein-DNA-RNA complex disassembly Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0032211 negative regulation of telomere maintenance via telomerase Biological Process

GO:0000781 chromosome, telomeric region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0042645 mitochondrial nucleoid Cellular Component

GO:0000287 magnesium ion binding Molecular Function

KEGG gene cross-reference

hsa:80119

mmu:208084

rno:367645

xla:734585

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.297

Rank 1 · TkA01G019920 · TK1151

Cytoplasm0.288

Rank 2 · TkA01G019920 · TK1151

Peroxisome0.166

Rank 3 · TkA01G019920 · TK1151

Nucleus0.128

Rank 4 · TkA01G019920 · TK1151

Mitochondrion0.093

Rank 5 · TkA01G019920 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45027-135 aa

PF05970PIF1203-239 aa

PF21530Pif1_2B_dom341-385 aa

PF01443Viral_helicase1431-471 aa

PF02689Herpes_Helicase432-476 aa

PF13538UvrD_C_2433-468 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G019920	`PF00067`	p450	27	135	3.2e-14	53.3
TkA01G019920	`PF05970`	PIF1	203	239	0.00075	19.9
TkA01G019920	`PF21530`	Pif1_2B_dom	341	385	6.1e-20	71.4
TkA01G019920	`PF01443`	Viral_helicase1	431	471	0.23	12.0
TkA01G019920	`PF02689`	Herpes_Helicase	432	476	0.0053	15.5
TkA01G019920	`PF13538`	UvrD_C_2	433	468	0.092	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LUC5`	Arabidopsis thaliana	sp\|Q9LUC5\|C7A15_ARATH Cytochrome P450 72A15	53.500%	Swiss-Prot	Low
`Q9LUC6`	Arabidopsis thaliana	sp\|Q9LUC6\|C7A14_ARATH Cytochrome P450 72A14	54.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card