TkA01G019370 | RubberDandelionOmics

Gene overview

TkA01G019370

Reference: TK1151 Chr: Chr01 Coordinates: 4966860-4970380 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2283 bp · TkA01G019370|TK1151|cDNA

ATGAAACCATAAGGAGCAAAGATATTATAGAGTGAGATTGTAAGGTTTTATAAATCGCGGGTACCATTTTACAATTATGTCAAAATCAATAAAGAAAGATATAGAAGAGGGAGTTTTTTTTTGTAATATTGTTCAGATCCTGTATATTACTGATAAACCTTCAAGTAGTTGTTCATGTGAAGAAGGAGCAAACGAGTGACCCAACTTGAGATCTAATGGGTAATTGTCTGCCGATGGAAGATTTAAGCAAGCTATTTCGG...

CDS

Download CDS FASTA

1962 bp · TkA01G019370|TK1151|CDS

ATGGGTAATTGTCTGCCGATGGAAGATTTAAGCAAGCTATTTCGGCCTCGCCGGGATGAGTTTCTCAAACTATCTCAAGACGACAAACTCTGCGCATTCCTTGCAACGTTTCCAACTCAACTTCAATATACGAAACCTCAGTTCTACTTCATATTATGGGTTTTTTGGAGTCAACAAGCAGTATCTCGAAATAATTCATCTTCAAGTGAGTCTCCTCTATATTCAATTTCAGGCGACACCAGCGAATTTGTAATCCACGA...

Protein

Download Protein FASTA

653 aa · TkA01G019370|TK1151|PROTEIN

MGNCLPMEDLSKLFRPRRDEFLKLSQDDKLCAFLATFPTQLQYTKPQFYFILWVFWSQQAVSRNNSSSSESPLYSISGDTSEFVIHEKIRSSFYKFDLTLYDFDGLIQFWAPVTTGGRRLLSTSDQPFAVNYLDTGLDKFRLCSLNYRYNIDVNTLDVDKETTIISGAPASAFLNHLPEVVLDLKAHDNGCPLVRSALECDLMAYIVLPVRDPSQRCCVGVVECFMKRSDCSLVIFNKLNESLEGVGLSTFDVRECLPYK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G019370`
TK1151 ID	TkA01G019370
OH-1004 ID	LXL04_005739
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	88.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G019370

Location Chr01:4966860-4970380 (+)

Description Similar to NLP6: Protein NLP6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24020`	Transcription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal.	The nodule inception-like protein 7 modulates nitrate sensing and metabolism in Arabidopsis.2009 · DOI: 10.1111/j.1365-313x.2008.03695.x
`At1g64530`	Probable transcription factor.	No verified direct reference in this release
`At3g59580`	Probable transcription factor.	No verified direct reference in this release
`At1g76350`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0131100`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005739 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0010118 stomatal movement Biological Process

GO:0010167 response to nitrate Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0001046 core promoter sequence-specific DNA binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G64530

ath:AT4G24020

dosa:Os01g0236700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.697

Rank 1 · TkA01G019370 · TK1151

Cytoplasm0.305

Rank 2 · TkA01G019370 · TK1151

Cell membrane0.102

Rank 3 · TkA01G019370 · TK1151

Endoplasmic reticulum0.050

Rank 4 · TkA01G019370 · TK1151

Plastid0.022

Rank 5 · TkA01G019370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00564PB1124-139 aa

PF22922GAF_NLP189-229 aa

PF02042RWP-RK258-277 aa

PF22922GAF_NLP266-419 aa

PF01051Rep3_N467-518 aa

PF01710HTH_Tnp_IS630473-536 aa

PF02042RWP-RK478-527 aa

PF00564PB1568-648 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G019370	`PF00564`	PB1	124	139	7.3e-11	42.6
TkA01G019370	`PF22922`	GAF_NLP	189	229	4.9e-28	98.5
TkA01G019370	`PF02042`	RWP-RK	258	277	2.2e-12	47.7
TkA01G019370	`PF22922`	GAF_NLP	266	419	4.9e-28	98.5
TkA01G019370	`PF01051`	Rep3_N	467	518	0.05	14.7
TkA01G019370	`PF01710`	HTH_Tnp_IS630	473	536	0.043	14.6
TkA01G019370	`PF02042`	RWP-RK	478	527	2.2e-12	47.7
TkA01G019370	`PF00564`	PB1	568	648	7.3e-11	42.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84TH9`	Arabidopsis thaliana	sp\|Q84TH9\|NLP7_ARATH Protein NLP7	27.200%	Swiss-Prot	Low
`Q8RWY4`	Arabidopsis thaliana	sp\|Q8RWY4\|NLP6_ARATH Protein NLP6	28.000%	Swiss-Prot	Low
`Q9M1B0`	Arabidopsis thaliana	sp\|Q9M1B0\|NLP9_ARATH Protein NLP9	27.800%	Swiss-Prot	Low
`Q9SFW8`	Arabidopsis thaliana	sp\|Q9SFW8\|NLP5_ARATH Protein NLP5	26.500%	Swiss-Prot	Low
`Q10S83`	Oryza sativa subsp. japonica	sp\|Q10S83\|NLP1_ORYSJ Protein NLP1	30.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card