TkA01G017180 | RubberDandelionOmics

Gene overview

TkA01G017180

Reference: TK1151 Chr: Chr01 Coordinates: 4378589-4379908 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

912 bp · TkA01G017180|TK1151|cDNA

ATGACCCAACTGAAGCCAATTCTCTCTCACGTCGATAACATCCCGTCGACCGCCGGAAAATTCAAACCCGACAAATCTTCTCTGTACTACATCCACCATCGTCTCCGGTACCAAACTTCTTTCCCCAAATTTACAATTTGGTCCACGATGTTTCTCTCATTGATTGTTCTGTTCTTCTTCTTATCCCCTCCTGCCACTCCCGCCCCTCGCCGTGGCCTCCGTACAACCAATTCCTACGAAGGAACCCCGCTCCCGAACTG...

CDS

Download CDS FASTA

912 bp · TkA01G017180|TK1151|CDS

ATGACCCAACTGAAGCCAATTCTCTCTCACGTCGATAACATCCCGTCGACCGCCGGAAAATTCAAACCCGACAAATCTTCTCTGTACTACATCCACCATCGTCTCCGGTACCAAACTTCTTTCCCCAAATTTACAATTTGGTCCACGATGTTTCTCTCATTGATTGTTCTGTTCTTCTTCTTATCCCCTCCTGCCACTCCCGCCCCTCGCCGTGGCCTCCGTACAACCAATTCCTACGAAGGAACCCCGCTCCCGAACTG...

Protein

Download Protein FASTA

303 aa · TkA01G017180|TK1151|PROTEIN

MTQLKPILSHVDNIPSTAGKFKPDKSSLYYIHHRLRYQTSFPKFTIWSTMFLSLIVLFFFLSPPATPAPRRGLRTTNSYEGTPLPNWSYSVCSFYGLNSKVPFSEKDRTDQPASLYAATKKAGEEIAHAYNHIYSLSITGLRFFTVYGPWGRPDMAYFFFTKDILNRKQISIFEGPNHGTIARDFTYIDDIVNGCLSAIDTAKKSTGTGGKKKGEAQFRIINLGNTSPVSVHKLVNILEKLLKVKEKKVVLMPRNGDVPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G017180`
TK1151 ID	TkA01G017180
OH-1004 ID	LXL04_014409
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	87.600
Protein coverage (%)	TK1151 90.099 / OH-1004 85.625 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G017180

Location Chr01:4378589-4379908 (+)

Description Similar to GAE4: UDP-glucuronate 4-epimerase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g45310`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At4g12250`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At4g00110`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At1g02000`	Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	No verified direct reference in this release
`At4g30440`	UDP-D-glucuronate 4-epimerase involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.	The biosynthesis of D-Galacturonate in plants. functional cloning and characterization of a membrane-anchored UDP-D-Glucuronate 4-epimerase from Arabidopsis.2004 · DOI: 10.1104/pp.104.043745

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014409 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016020 membrane Cellular Component

GO:0032580 Golgi cisterna membrane Cellular Component

GO:0016854 racemase and epimerase activity Molecular Function

GO:0050378 UDP-glucuronate 4-epimerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G02000

ath:AT2G45310

ath:AT4G00110

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.232

Rank 1 · TkA01G017180 · TK1151

Mitochondrion0.222

Rank 2 · TkA01G017180 · TK1151

Peroxisome0.167

Rank 3 · TkA01G017180 · TK1151

Endoplasmic reticulum0.123

Rank 4 · TkA01G017180 · TK1151

Nucleus0.099

Rank 5 · TkA01G017180 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01370Epimerase91-203 aa

PF16363GDP_Man_Dehyd93-286 aa

PF04321RmlD_sub_bind99-174 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G017180	`PF01370`	Epimerase	91	203	9.3e-19	68.5
TkA01G017180	`PF16363`	GDP_Man_Dehyd	93	286	3.7e-15	56.9
TkA01G017180	`PF04321`	RmlD_sub_bind	99	174	0.046	13.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22141`	Arabidopsis thaliana	sp\|O22141\|GAE4_ARATH UDP-glucuronate 4-epimerase 4	72.700%	Swiss-Prot	High
`Q9STI6`	Arabidopsis thaliana	sp\|Q9STI6\|GAE5_ARATH UDP-glucuronate 4-epimerase 5	73.000%	Swiss-Prot	High
`O81312`	Arabidopsis thaliana	sp\|O81312\|GAE3_ARATH UDP-glucuronate 4-epimerase 3	71.400%	Swiss-Prot	High
`Q9LPC1`	Arabidopsis thaliana	sp\|Q9LPC1\|GAE2_ARATH UDP-glucuronate 4-epimerase 2	73.200%	Swiss-Prot	High
`Q9M0B6`	Arabidopsis thaliana	sp\|Q9M0B6\|GAE1_ARATH UDP-glucuronate 4-epimerase 1	72.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card