TkA01G016380 | RubberDandelionOmics

Gene overview

TkA01G016380

Reference: TK1151 Chr: Chr01 Coordinates: 4188980-4191468 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1323 bp · TkA01G016380|TK1151|cDNA

ATGAACAAAACGGAGGGAAGTGTTCGCATCAAAATCTCATCCAGTTCCAAAGATAAACTGCCTGAAACCAGAAACGAATTCATAGTTTGGATGCATAAAATCTGGGAATTTGCTAAAGAAGACAATAACAGAGTGACATTTGCTCTAAAAGTTGGACTTGCGGTTCTTCTTGTGTCTTTACTCGTACTACTTCAAGCACCTTATGAAGTCCTCAGCACCAGCATTATCTGGTCTATCCTCACTGTCGTCATCATGTTTGA...

CDS

Download CDS FASTA

1323 bp · TkA01G016380|TK1151|CDS

ATGAACAAAACGGAGGGAAGTGTTCGCATCAAAATCTCATCCAGTTCCAAAGATAAACTGCCTGAAACCAGAAACGAATTCATAGTTTGGATGCATAAAATCTGGGAATTTGCTAAAGAAGACAATAACAGAGTGACATTTGCTCTAAAAGTTGGACTTGCGGTTCTTCTTGTGTCTTTACTCGTACTACTTCAAGCACCTTATGAAGTCCTCAGCACCAGCATTATCTGGTCTATCCTCACTGTCGTCATCATGTTTGA...

Protein

Download Protein FASTA

440 aa · TkA01G016380|TK1151|PROTEIN

MNKTEGSVRIKISSSSKDKLPETRNEFIVWMHKIWEFAKEDNNRVTFALKVGLAVLLVSLLVLLQAPYEVLSTSIIWSILTVVIMFEYTVGATFHKGFNRVLGSLFAGVLAIAVAELALMSGPVVEPIVIGISIFIIGSIISFVKLWPTFVPYEYGFRVILFTYCLIIVSGYRAGNPIRTTIDRLYTIAIGAVVAIAVNTIIVPIWAGEQLHKELVKHFNSVADSFEECVNKYLRDNGSDHSEFTSILMDGFPDEPVYNN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G016380`
TK1151 ID	TkA01G016380
OH-1004 ID	LXL04_035423
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	36.400
Protein coverage (%)	TK1151 94.773 / OH-1004 87.179 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G016380

Location Chr01:4188980-4191468 (-)

Description Similar to ALMT9: Aluminum-activated malate transporter 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18440`	Vacuolar malate channel.	The Arabidopsis vacuolar malate channel is a member of the ALMT family.2007 · DOI: 10.1111/j.1365-313x.2007.03367.x
`At1g25480`	Malate transporter.	No verified direct reference in this release
`At1g18420`	Malate transporter.	No verified direct reference in this release
`At2g17470`	Malate transporter.	No verified direct reference in this release
`At1g68600`	Malate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035423 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0015743 malate transport Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0071423 malate transmembrane transport Biological Process

GO:0090332 stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT1G18420

ath:AT1G25480

ath:AT1G68600

ath:AT2G17470

ath:AT3G18440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.800

Rank 1 · TkA01G016380 · TK1151

Endoplasmic reticulum0.108

Rank 2 · TkA01G016380 · TK1151

Lysosome / Vacuole0.068

Rank 3 · TkA01G016380 · TK1151

Cytoplasm0.062

Rank 4 · TkA01G016380 · TK1151

Golgi apparatus0.029

Rank 5 · TkA01G016380 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11712Vma1228-64 aa

PF11744ALMT35-395 aa

PF04632FUSC45-237 aa

PF31010RBR_HH56-137 aa

PF13515FUSC_273-198 aa

PF11712Vma1275-122 aa

PF31010RBR_HH187-218 aa

PF11744ALMT395-430 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G016380	`PF11712`	Vma12	28	64	0.9	10.2
TkA01G016380	`PF11744`	ALMT	35	395	3.8e-148	495.0
TkA01G016380	`PF04632`	FUSC	45	237	1.1e-10	41.5
TkA01G016380	`PF31010`	RBR_HH	56	137	1.7	9.7
TkA01G016380	`PF13515`	FUSC_2	73	198	3.9e-11	43.9
TkA01G016380	`PF11712`	Vma12	75	122	0.9	10.2
TkA01G016380	`PF31010`	RBR_HH	187	218	1.7	9.7
TkA01G016380	`PF11744`	ALMT	395	430	3.8e-148	495.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS46`	Arabidopsis thaliana	sp\|Q9LS46\|ALMT9_ARATH Aluminum-activated malate transporter 9	36.900%	Swiss-Prot	Medium
`Q9C6L8`	Arabidopsis thaliana	sp\|Q9C6L8\|ALMT4_ARATH Aluminum-activated malate transporter 4	34.300%	Swiss-Prot	Medium
`Q9LPQ8`	Arabidopsis thaliana	sp\|Q9LPQ8\|ALMT3_ARATH Putative aluminum-activated malate transporter 3	34.700%	Swiss-Prot	Medium
`Q9SHM1`	Arabidopsis thaliana	sp\|Q9SHM1\|ALMT6_ARATH Aluminum-activated malate transporter 6	35.200%	Swiss-Prot	Medium
`Q93Z29`	Arabidopsis thaliana	sp\|Q93Z29\|ALMT5_ARATH Aluminum-activated malate transporter 5	33.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card