LXL04_035423 | RubberDandelionOmics

Gene overview

LXL04_035423

Reference: OH-1004 Chr: Chr08 Coordinates: 22295011-22298395 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1758 bp · LXL04_035423|LXL04_035423|OH1004|cDNA

ATGAcagccaatctaggatccaTGTCGCGCAATTTTACAGACAAAAGCAAAGAAAGGTTGCTGCCTCGAAAGGGATACTCGGAATTAGGTTTTTTTAATGAATCCTATAGCACCATCAACAGCGAAGATGCTTCACTTTTCAGTAAAATCAAGGAATGGTGGAACGATGTTCGACTGTTCCTTGTTAAAGCTTACGAGATGGGCCGCTCCGATCCCAGACAGTTCATCTTTGCTGCTAAATCGGGGTTGGCACTTGCTAT...

CDS

Download CDS FASTA

1758 bp · LXL04_035423|LXL04_035423|OH1004|CDS

ATGACAGCCAATCTAGGATCCATGTCGCGCAATTTTACAGACAAAAGCAAAGAAAGGTTGCTGCCTCGAAAGGGATACTCGGAATTAGGTTTTTTTAATGAATCCTATAGCACCATCAACAGCGAAGATGCTTCACTTTTCAGTAAAATCAAGGAATGGTGGAACGATGTTCGACTGTTCCTTGTTAAAGCTTACGAGATGGGCCGCTCCGATCCCAGACAGTTCATCTTTGCTGCTAAATCGGGGTTGGCACTTGCTAT...

Protein

Download Protein FASTA

585 aa · LXL04_035423|LXL04_035423|OH1004|PROTEIN

MTANLGSMSRNFTDKSKERLLPRKGYSELGFFNESYSTINSEDASLFSKIKEWWNDVRLFLVKAYEMGRSDPRQFIFAAKSGLALAIVSVLIFFKEPFNFITQYSIWAILTVIVVFEFSIGATLSKGFNRALGTFSAGVLALAIAQLSVWAGEWQEIVIVVSIFVAGSISSYVKLYPSMKPYEYGFRVFMLTFCIVLVSGTSHFVQTAVSRLLLIGVGAGVCLIVNICVYPIWAGEDLHKLVVKNFRGVATSLEGCVNNY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035423`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035423

Location Chr08:22295011-22298395 (-)

Description Similar to ALMT9: Aluminum-activated malate transporter 9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g18440`	Vacuolar malate channel.	The Arabidopsis vacuolar malate channel is a member of the ALMT family.2007 · DOI: 10.1111/j.1365-313x.2007.03367.x
`At1g25480`	Malate transporter.	No verified direct reference in this release
`At1g68600`	Malate transporter.	No verified direct reference in this release
`At2g17470`	Malate transporter.	No verified direct reference in this release
`At1g18420`	Malate transporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035423 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015743 malate transport Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0034220 monoatomic ion transmembrane transport Biological Process

GO:0071423 malate transmembrane transport Biological Process

GO:0090332 stomatal closure Biological Process

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

KEGG gene cross-reference

ath:AT1G18420

ath:AT1G25480

ath:AT1G68600

ath:AT2G17470

ath:AT3G18440

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.686

Rank 1 · LXL04_035423 · OH-1004

Lysosome / Vacuole0.113

Rank 2 · LXL04_035423 · OH-1004

Endoplasmic reticulum0.112

Rank 3 · LXL04_035423 · OH-1004

Cytoplasm0.071

Rank 4 · LXL04_035423 · OH-1004

Golgi apparatus0.047

Rank 5 · LXL04_035423 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11744.15ALMT66-553 aa

PF13515.13FUSC_2100-225 aa

PF04632.19FUSC107-258 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035423	`PF11744.15`	ALMT	66	553	8e-180	599.5
LXL04_035423	`PF13515.13`	FUSC_2	100	225	6.1e-10	40.0
LXL04_035423	`PF04632.19`	FUSC	107	258	1.2e-06	28.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LS46`	Arabidopsis thaliana	Aluminum-activated malate transporter 9	52.512%	Swiss-Prot	strong database homology
`Q9C6L8`	Arabidopsis thaliana	Aluminum-activated malate transporter 4	56.890%	Swiss-Prot	strong database homology
`Q93Z29`	Arabidopsis thaliana	Aluminum-activated malate transporter 5	59.646%	Swiss-Prot	strong database homology
`Q9SHM1`	Arabidopsis thaliana	Aluminum-activated malate transporter 6	54.291%	Swiss-Prot	strong database homology
`Q9LPQ8`	Arabidopsis thaliana	Putative aluminum-activated malate transporter 3	52.715%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card