RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA01G007170
Reference: TK1151 Chr: Chr01 Coordinates: 1859291-1860769 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

858 bp · TkA01G007170|TK1151|cDNA

ATGTCTGCGGGCGGAAGAGATTTTGGTCTGCAGAGTCGAAAAGAGCGTTTGTTTTTTGGAAGACAAAAGAGGCTTGCAGAGGTAAAAACGTCTGCGGGCGGGAAGATGTGGTTAAGGCAAACTCGAAATCGGCCGGTATTACCTCCGATCGCAGCTAAGCTAGACGTCGCCGGCCCCGAAATCGCGGGCATTAACTCCGTTCGCGACTTTCTAGACCACCGCGCTGCTCTCGACCACCGGACCACCTACAATCGCACCTG...

CDS

Download CDS FASTA

462 bp · TkA01G007170|TK1151|CDS

ATGTCTGCGGGCGGAAGAGATTTTGGTCTGCAGAGTCGAAAAGAGCGTTTGTTTTTTGGAAGACAAAAGAGGCTTGCAGAGGTAAAAACGTCTGCGGGCGGGAAGATGTGGTTAAGGCAAACTCGAAATCGGCCGGTATTACCTCCGATCGCAGCTAAGCTAGACGTCGCCGGCCCCGAAATCGCGGGCATTAACTCCGTTCGCGACTTTCTAGACCACCGCGCTGCTCTCGACCACCGGACCACCTACAATCGCACCTG...

Protein

Download Protein FASTA

153 aa · TkA01G007170|TK1151|PROTEIN

MSAGGRDFGLQSRKERLFFGRQKRLAEVKTSAGGKMWLRQTRNRPVLPPIAAKLDVAGPEIAGINSVRDFLDHRAALDHRTTYNRTCSIPPVQPPSCSTPPSSSARPSCSAPLSCSAPPSSFLRFHSVKRFMFNGELHYLAMLALDVMLQGET

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA01G007170
TK1151 IDTkA01G007170
OH-1004 IDLXL04_005690
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)60.800
Protein coverage (%)TK1151 48.366 / OH-1004 43.373
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA01G007170
LocationChr01:1859291-1860769 (+)
DescriptionSimilar to CCT1: T-complex protein 1 subunit alpha
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_005690 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006457 protein folding Biological Process
GO:0007021 tubulin complex assembly Biological Process
GO:0032212 positive regulation of telomere maintenance via telomerase Biological Process
GO:0050821 protein stabilization Biological Process
GO:0090666 scaRNA localization to Cajal body Biological Process
GO:1904851 positive regulation of establishment of protein localization to telomere Biological Process
GO:1904871 positive regulation of protein localization to Cajal body Biological Process
GO:1904874 positive regulation of telomerase RNA localization to Cajal body Biological Process
GO:0000242 pericentriolar material Cellular Component
GO:0000792 heterochromatin Cellular Component
GO:0001669 acrosomal vesicle Cellular Component
GO:0002199 zona pellucida receptor complex Cellular Component
KEGG gene cross-reference
ath:AT3G20050
cge:100689476
hsa:6950
mdo:497250
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.412
Rank 1 · TkA01G007170 · TK1151
Cytoplasm0.401
Rank 2 · TkA01G007170 · TK1151
Mitochondrion0.126
Rank 3 · TkA01G007170 · TK1151
Cell membrane0.112
Rank 4 · TkA01G007170 · TK1151
Endoplasmic reticulum0.076
Rank 5 · TkA01G007170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser