TkA01G002790 | RubberDandelionOmics

Gene overview

TkA01G002790

Reference: TK1151 Chr: Chr01 Coordinates: 726272-731513 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

564 bp · TkA01G002790|TK1151|cDNA

ATGTCAGAAACCAATGAATCTGGACCTTCTTTTGCAAAAACAACTTATACTGTAGCTGTCCCCATCCGTTCTGTTGCTCCCATTACTAAACCACACACCAACAACAAGAAGAAAAAAAACAAACTTCCTTCCAAAACCCCAAAACCCCCAAAAACTCCCACCCAAACCAACCCTTCAATTTCCAAAAAATCCAAGAAAAAAAAACCCATCCTAAAACCAAACGTCGAGAGAAAGAATCCCGACACCACTTTTGATGAATC...

CDS

Download CDS FASTA

1917 bp · TkA01G002790|TK1151|CDS

ATGGAACTATCTCCCCAAGAACTACCATCAACGATCAATATATTCTCCACTCCATCATGTCCCATTTCTTCAAAACCTCCACACAAGGAAACCCAATTTAATACGTCGCTCAAGGCCTTTAAAATTGCTTCAATTACAGCTCACGGCTCTCAATTCAAGTTTTTGAAACCGGGTACTCAAAGAACGAGGTCTAATCGAATCGTTTCGCTAAAATCTGCAGGCTCAGATACCAGCATTACCTCCAATTTACTTCAAACTGC...

Protein

Download Protein FASTA

638 aa · TkA01G002790|TK1151|PROTEIN

MELSPQELPSTINIFSTPSCPISSKPPHKETQFNTSLKAFKIASITAHGSQFKFLKPGTQRTRSNRIVSLKSAGSDTSITSNLLQTALGVVHLAVSLGIILAADKYLKQAFVAAAIKFPSALFGMFCIFTVLVILDVTIPAAATALVNFFEPALLFIQRWLPLFYVPSLVVLPLAVQDIPAASGLKICFILVTGWLASLAVAGYTAIAVRKMVKTEMIAAEPMAKPSAFSTLEVVAWSVISVASFVAALKYPELLGTNAR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA01G002790`
TK1151 ID	TkA01G002790
OH-1004 ID	LXL04_005993
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.200
Protein coverage (%)	TK1151 81.818 / OH-1004 96.022 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA01G002790

Location Chr01:726272-731513 (-)

Description Similar to PLGG1: Plastidal glycolate/glycerate translocator 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g32080`	Glycolate/glycerate transporter required for photorespiration.	A chloroplast envelope membrane protein containing a putative LrgB domain related to the control of bacterial death and lysis is required for chloroplast development in Arabidopsis thaliana.2012 · DOI: 10.1111/j.1469-8137.2011.03867.x Loss of the plastid envelope protein AtLrgB causes spontaneous chlorotic cell death in Arabidopsis thaliana.2012 · DOI: 10.1093/pcp/pcr180
`At2g35550`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release
`At2g01930`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	BASIC PENTACYSTEINE1, a GA binding protein that induces conformational changes in the regulatory region of the homeotic Arabidopsis gene SEEDSTICK.2005 · DOI: 10.1105/tpc.104.030130
`At1g14685`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release
`At1g68120`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0114500`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release
`Os10g0115200`	Transcriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005993 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009853 photorespiration Biological Process

GO:0010118 stomatal movement Biological Process

GO:0012501 programmed cell death Biological Process

GO:0019835 cytolysis Biological Process

GO:0031640 killing of cells of another organism Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0048527 lateral root development Biological Process

GO:0097339 glycolate transmembrane transport Biological Process

GO:1901975 glycerate transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G32080

bsu:BSU38330

sep:SE_2014

ser:SERP2027

ssp:SSP0461

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.972

Rank 1 · TkA01G002790 · TK1151

Mitochondrion0.027

Rank 2 · TkA01G002790 · TK1151

Cell membrane0.015

Rank 3 · TkA01G002790 · TK1151

Nucleus0.012

Rank 4 · TkA01G002790 · TK1151

Cytoplasm0.012

Rank 5 · TkA01G002790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25946DUF798577-150 aa

PF04172LrgB81-138 aa

PF03788LrgA114-205 aa

PF04172LrgB170-170 aa

PF03788LrgA242-276 aa

PF04172LrgB270-484 aa

PF03788LrgA322-381 aa

PF25946DUF7985350-388 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA01G002790	`PF25946`	DUF7985	77	150	0.04	14.8
TkA01G002790	`PF04172`	LrgB	81	138	2.4e-35	122.6
TkA01G002790	`PF03788`	LrgA	114	205	0.00015	22.4
TkA01G002790	`PF04172`	LrgB	170	170	2.4e-35	122.6
TkA01G002790	`PF03788`	LrgA	242	276	0.00015	22.4
TkA01G002790	`PF04172`	LrgB	270	484	2.4e-35	122.6
TkA01G002790	`PF03788`	LrgA	322	381	0.00015	22.4
TkA01G002790	`PF25946`	DUF7985	350	388	0.04	14.8
TkA01G002790	`PF06217`	GAGA_bind	509	547	2.4e-44	153.4
TkA01G002790	`PF06217`	GAGA_bind	554	638	2.4e-44	153.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FVQ4`	Arabidopsis thaliana	sp\|Q9FVQ4\|PLGG1_ARATH Plastidal glycolate/glycerate translocator 1, chloroplastic	77.000%	Swiss-Prot	High
`O82286`	Arabidopsis thaliana	sp\|O82286\|BPC7_ARATH Protein BASIC PENTACYSTEINE7	58.100%	Swiss-Prot	High
`Q9SKD0`	Arabidopsis thaliana	sp\|Q9SKD0\|BPC1_ARATH Protein BASIC PENTACYSTEINE1	48.500%	Swiss-Prot	Medium
`Q9LDE2`	Arabidopsis thaliana	sp\|Q9LDE2\|BPC2_ARATH Protein BASIC PENTACYSTEINE2	54.100%	Swiss-Prot	Medium
`Q9C9X6`	Arabidopsis thaliana	sp\|Q9C9X6\|BPC3_ARATH Protein BASIC PENTACYSTEINE3	60.000%	Swiss-Prot	Low
`P0DH88`	Oryza sativa subsp. japonica	sp\|P0DH88\|BBRA_ORYSJ Barley B recombinant-like protein A	56.800%	Swiss-Prot	Medium
`P0DH89`	Oryza sativa subsp. japonica	sp\|P0DH89\|BBRB_ORYSJ Barley B recombinant-like protein B	56.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card