Gene Card
Gene overview
cDNA / CDS / Protein Sequences
927 bp · TkA01G001370|TK1151|cDNA
ATGTCGAATTCGAAAGTAGTGTATGAAGGGTGGATGGTGCGATATGGGAGGAGGAAATCGGGAGATCTTTTATTCATATGCGGTTTTTTTGTGCTGGAATCAAGATTGCTTGCTTATTACAAGAGGAAGCCTCAAGATAACATGGTTCCCATCAAGACATTGGTTATAGATGGCAACTGCAGAGTGGAGGACCGAGGCTTAAAAACCCAACAAGGACTTATGGTGTATGTTTTGCTTATATACAACAAGAAAGATAAATA...
927 bp · TkA01G001370|TK1151|CDS
ATGTCGAATTCGAAAGTAGTGTATGAAGGGTGGATGGTGCGATATGGGAGGAGGAAATCGGGAGATCTTTTATTCATATGCGGTTTTTTTGTGCTGGAATCAAGATTGCTTGCTTATTACAAGAGGAAGCCTCAAGATAACATGGTTCCCATCAAGACATTGGTTATAGATGGCAACTGCAGAGTGGAGGACCGAGGCTTAAAAACCCAACAAGGACTTATGGTGTATGTTTTGCTTATATACAACAAGAAAGATAAATA...
Protein
Download Protein FASTA309 aa · TkA01G001370|TK1151|PROTEIN
MSNSKVVYEGWMVRYGRRKSGDLLFICGFFVLESRLLAYYKRKPQDNMVPIKTLVIDGNCRVEDRGLKTQQGLMVYVLLIYNKKDKYHRMTMAAFNIQEALIWKEKIESVIDQHQESLTANGNKYQSFEYKSGMDSGRNASSSDQESQYSAAEDEDDSNPSLLRRTTLEMGPPESILDWTQESSALASQNTSNQAISRKHWRLLQCQNGLRIFEELLEVDFLPKSCSRAMKATGVVEASCEEVFELVMSMDGTPLRWDCS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA01G001370 |
|---|---|
| TK1151 ID | TkA01G001370 |
| OH-1004 ID | LXL04_006005 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 94.200 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 41.365Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA01G001370 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr01:328099-330084 (+) | |||||||||
| Description | Similar to EDR2L: Protein ENHANCED DISEASE RESISTANCE 2-like | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009626 plant-type hypersensitive response Biological Process GO:0009723 response to ethylene Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009873 ethylene-activated signaling pathway Biological Process GO:1900056 negative regulation of leaf senescence Biological Process GO:1900150 regulation of defense response to fungus Biological Process GO:0005739 mitochondrion Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0010008 endosome membrane Cellular Component GO:0008289 lipid binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT4G19040 ath:AT5G45560 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00169PH6-111 aaPF01852START11-27 aaPF01852START225-306 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA01G001370 | PF00169 | PH | 6 | 111 | 0.00083 | 20.6 |
| TkA01G001370 | PF01852 | START | 11 | 27 | 1.4e-08 | 35.1 |
| TkA01G001370 | PF01852 | START | 225 | 306 | 1.4e-08 | 35.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.