LXL04_006005 | RubberDandelionOmics

Gene overview

LXL04_006005

Reference: OH-1004 Chr: Chr01 Coordinates: 176868057-176872487 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2244 bp · LXL04_006005|LXL04_006005|OH1004|cDNA

ATGTCGAATTCGAAAGTAGTGTATGAAGGGTGGATGGTGCGATATGGGAGGAGGAAAATCGGGAGATCTTTTATTCATATGCGGTTTTTTGTGCTGGAATCAAGATTGCTTGCTTATTACAAGAGGAAGCCTCAAGATAACATGGTTCCCATCAAGACATTGGTTATAGATGGCAACTGCAGAGTGGAGGACCGAGGCTTAAAAACCCAACAAGGacttATGGTGTATGTTTTGCTTATATACAACAAGAAAGATAAATA...

CDS

Download CDS FASTA

2244 bp · LXL04_006005|LXL04_006005|OH1004|CDS

ATGTCGAATTCGAAAGTAGTGTATGAAGGGTGGATGGTGCGATATGGGAGGAGGAAAATCGGGAGATCTTTTATTCATATGCGGTTTTTTGTGCTGGAATCAAGATTGCTTGCTTATTACAAGAGGAAGCCTCAAGATAACATGGTTCCCATCAAGACATTGGTTATAGATGGCAACTGCAGAGTGGAGGACCGAGGCTTAAAAACCCAACAAGGACTTATGGTGTATGTTTTGCTTATATACAACAAGAAAGATAAATA...

Protein

Download Protein FASTA

747 aa · LXL04_006005|LXL04_006005|OH1004|PROTEIN

MSNSKVVYEGWMVRYGRRKIGRSFIHMRFFVLESRLLAYYKRKPQDNMVPIKTLVIDGNCRVEDRGLKTQQGLMVYVLLIYNKKDKYHRMTMAAFNIQEALIWKEKIESVIDQHQESLTANGNKYQSFEYKSGMDSGRNASSSDQESQYSAAEDEDDSNPSLLRRTTIGNGPPESILDWTQESSALASQNTSNQAISRKHWRLLQCQNGLRIFEELLEVDFLPKSCSRAMKATGVVEASCEEVFELVMSMDGTRSEWDCS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006005`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006005

Location Chr01:176868057-176872487 (+)

Description Similar to EDR2L: Protein ENHANCED DISEASE RESISTANCE 2-like

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45560`	Binds to phosphatidylinositol-4-phosphate (PtdIns(4)P).	No verified direct reference in this release
`At4g19040`	May negatively regulate salicylic acid-mediated disease resistance.	Regulation of plant defense responses in Arabidopsis by EDR2, a PH and START domain-containing protein.2005 · DOI: 10.1111/j.1365-313x.2005.02523.x EDR2 negatively regulates salicylic acid-based defenses and cell death during powdery mildew infections of Arabidopsis thaliana.2007 · DOI: 10.1186/1471-2229-7-35

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006005 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:1900056 negative regulation of leaf senescence Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0008289 lipid binding Molecular Function

KEGG gene cross-reference

ath:AT4G19040

ath:AT5G45560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.492

Rank 1 · LXL04_006005 · OH-1004

Nucleus0.288

Rank 2 · LXL04_006005 · OH-1004

Cell membrane0.252

Rank 3 · LXL04_006005 · OH-1004

Golgi apparatus0.121

Rank 4 · LXL04_006005 · OH-1004

Lysosome / Vacuole0.093

Rank 5 · LXL04_006005 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01852.26START225-371 aa

PF07059.18EDR2_C529-733 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006005	`PF01852.26`	START	225	371	3e-24	86.3
LXL04_006005	`PF07059.18`	EDR2_C	529	733	1.2e-74	251.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VZF6`	Arabidopsis thaliana	Protein ENHANCED DISEASE RESISTANCE 2-like	76.043%	Swiss-Prot	strong database homology
`F4JSE7`	Arabidopsis thaliana	Protein ENHANCED DISEASE RESISTANCE 2	75.639%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card