LXL04_039708 | RubberDandelionOmics

Gene overview

LXL04_039708

Reference: OH-1004 Chr: JAJTUU010000029.1 Coordinates: 230860-231628 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · LXL04_039708|LXL04_039708|OH1004|cDNA

ATGGACTTCCACCGTTTTTTTGGAACATGGTACGAGCAACTCCACCACCAAATCCACCACCTCACCAAAGCCACCCGGCCACCCACCACCGACGACGACGACCACCAACTCACCCAACTCGTCAACAAAACCATGTTCCACTTCGTCGAGTACTACCGAGTCAAGTCCCTCGCCGCCAACCAAGACGTCCTCTCAATCTTCTCCGCTCGGTGGTCCACCACTCTCGAGCGCTCCCTCCACTGGATCGCCGGGTGGCGACC...

CDS

Download CDS FASTA

684 bp · LXL04_039708|LXL04_039708|OH1004|CDS

ATGGACTTCCACCGTTTTTTTGGAACATGGTACGAGCAACTCCACCACCAAATCCACCACCTCACCAAAGCCACCCGGCCACCCACCACCGACGACGACGACCACCAACTCACCCAACTCGTCAACAAAACCATGTTCCACTTCGTCGAGTACTACCGAGTCAAGTCCCTCGCCGCCAACCAAGACGTCCTCTCAATCTTCTCCGCTCGGTGGTCCACCACTCTCGAGCGCTCCCTCCACTGGATCGCCGGGTGGCGACC...

Protein

Download Protein FASTA

227 aa · LXL04_039708|LXL04_039708|OH1004|PROTEIN

MDFHRFFGTWYEQLHHQIHHLTKATRPPTTDDDDHQLTQLVNKTMFHFVEYYRVKSLAANQDVLSIFSARWSTTLERSLHWIAGWRPTTAFHLIYTESSILFESRILDILHGIRTGDLGDLSPAQFTRVSELQCETVQQENAITDLLSEWQDEASELIGGTCGDLDKKIGRLVQIVQKADELRLRTLKAVVELLTPQQAVEFLIAAAQLHFGIHRWGLNHDRERAEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039708`
TK1151 ID	TkA04G348130
OH-1004 ID	LXL04_039708
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.400
Protein coverage (%)	TK1151 84.932 / OH-1004 81.498 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039708

Location JAJTUU010000029.1:230860-231628 (-)

Description Similar to DOGL3: Protein DOG1-like 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18690`	Protein DOG1-like 3.	No verified direct reference in this release
`At4g18660`	Protein DOG1-like 1.	No verified direct reference in this release
`At4g18650`	Protein DOG1-like 4.	No verified direct reference in this release
`At4g18680`	Protein DOG1-like 2.	No verified direct reference in this release
`At5g45830`	Required for the induction of seed dormancy.	Cloning of DOG1, a quantitative trait locus controlling seed dormancy in Arabidopsis.2006 · DOI: 10.1073/pnas.0607877103 The Arabidopsis GSQ5/DOG1 Cvi allele is induced by the ABA-mediated sugar signalling pathway, and enhances sugar sensitivity by stimulating ABI4 expression.2008 · DOI: 10.1111/j.1365-313x.2008.03515.x The time required for dormancy release in Arabidopsis is determined by DELAY OF GERMINATION1 protein levels in freshly harvested seeds.2012 · DOI: 10.1105/tpc.112.100214 Seed Dormancy in Arabidopsis Is Controlled by Alternative Polyadenylation of DOG1.2016 · DOI: 10.1104/pp.15.01483 The Arabidopsis DELAY OF GERMINATION 1 gene affects ABSCISIC ACID INSENSITIVE 5 (ABI5) expression and genetically interacts with ABI3 during Arabidopsis seed development.2016 · DOI: 10.1111/tpj.13118 DELAY OF GERMINATION1 (DOG1) regulates both seed dormancy and flowering time through microRNA pathways.2016 · DOI: 10.1073/pnas.1600558113

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039708 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010162 seed dormancy process Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:2000033 regulation of seed dormancy process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0042802 identical protein binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT4G18650

ath:AT4G18660

ath:AT4G18680

ath:AT4G18690

ath:AT5G45830

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.559

Rank 1 · LXL04_039708 · OH-1004

Nucleus0.437

Rank 2 · LXL04_039708 · OH-1004

Plastid0.070

Rank 3 · LXL04_039708 · OH-1004

Mitochondrion0.059

Rank 4 · LXL04_039708 · OH-1004

Cell membrane0.058

Rank 5 · LXL04_039708 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14144.12DOG118-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039708	`PF14144.12`	DOG1	18	96	9.1e-27	93.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q58FV0`	Arabidopsis thaliana	Protein DOG1-like 3	27.160%	Swiss-Prot	weak database homology
`Q9SN47`	Arabidopsis thaliana	Protein DOG1-like 1	25.098%	Swiss-Prot	weak database homology
`Q84JC2`	Arabidopsis thaliana	Protein DOG1-like 4	28.879%	Swiss-Prot	weak database homology
`Q9SN45`	Arabidopsis thaliana	Protein DOG1-like 2	27.706%	Swiss-Prot	weak database homology
`A0SVK0`	Arabidopsis thaliana	Protein DELAY OF GERMINATION 1	25.333%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card