LXL04_039552 | RubberDandelionOmics

Gene overview

LXL04_039552

Reference: OH-1004 Chr: JAJTUU010000013.1 Coordinates: 948519-949889 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · LXL04_039552|LXL04_039552|OH1004|cDNA

ATGGCTACTAATTCAGTTGAGATCGAGAACTCAGAAGAATCGAAAGTTCATGTTTTCTCATCATCAACAGAGTTACTCGAGAAGTTGCATCAGAAATGGAATTCAGTCGAGAAGCCTCCATATCCAGCCATGTATTCAAGTGTTTACGGCGGAATTATTCTCGATCCAGCGATGATGGTCATCCCGATCGACGATCATATGGTACATCGAGGTCACGGCGTATTCGACACCGCCATAATTCTCGACGGATACCTCTACGA...

CDS

Download CDS FASTA

1020 bp · LXL04_039552|LXL04_039552|OH1004|CDS

ATGGCTACTAATTCAGTTGAGATCGAGAACTCAGAAGAATCGAAAGTTCATGTTTTCTCATCATCAACAGAGTTACTCGAGAAGTTGCATCAGAAATGGAATTCAGTCGAGAAGCCTCCATATCCAGCCATGTATTCAAGTGTTTACGGCGGAATTATTCTCGATCCAGCGATGATGGTCATCCCGATCGACGATCATATGGTACATCGAGGTCACGGCGTATTCGACACCGCCATAATTCTCGACGGATACCTCTACGA...

Protein

Download Protein FASTA

339 aa · LXL04_039552|LXL04_039552|OH1004|PROTEIN

MATNSVEIENSEESKVHVFSSSTELLEKLHQKWNSVEKPPYPAMYSSVYGGIILDPAMMVIPIDDHMVHRGHGVFDTAIILDGYLYELDAHLDRILISASKAKISSPFPKSTLRTILIQLTAASNIKKGTLRYWLTSGPGDFLLTPSNSQAPAFYAVVIDEQFSQCKHGVKVITSTIPMKVPLFATSKNVNYLPNVLSKLEAEEQGAFASIWVDDEGYVAEGPNVNVAFVTRGNELILPYFEKILSGCTAKRLLELAPKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039552`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039552

Location JAJTUU010000013.1:948519-949889 (+)

Description Similar to DAAT: D-amino-acid transaminase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g57850`	Amino acid aminotransferase showing activity for D-Asp and D-Ala as amino donors with 2-oxoglutarate as an amino acceptor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039552 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008153 4-aminobenzoate biosynthetic process Biological Process

GO:0009097 isoleucine biosynthetic process Biological Process

GO:0009098 L-leucine biosynthetic process Biological Process

GO:0009099 L-valine biosynthetic process Biological Process

GO:0019478 D-amino acid catabolic process Biological Process

GO:0019752 carboxylic acid metabolic process Biological Process

GO:0046437 D-amino acid biosynthetic process Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0008696 4-amino-4-deoxychorismate lyase activity Molecular Function

KEGG gene cross-reference

afu:AF_0933

ath:AT5G57850

lin:daaA

mja:MJ_1008

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.760

Rank 1 · LXL04_039552 · OH-1004

Nucleus0.244

Rank 2 · LXL04_039552 · OH-1004

Peroxisome0.100

Rank 3 · LXL04_039552 · OH-1004

Mitochondrion0.074

Rank 4 · LXL04_039552 · OH-1004

Cell membrane0.042

Rank 5 · LXL04_039552 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01063.25Aminotran_473-300 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039552	`PF01063.25`	Aminotran_4	73	300	2.7e-40	139.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8L493`	Arabidopsis thaliana	D-amino-acid transaminase, chloroplastic	57.367%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card