LXL04_039045 | RubberDandelionOmics

Gene overview

LXL04_039045

Reference: OH-1004 Chr: Chr09 Coordinates: 57405387-57411526 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3012 bp · LXL04_039045|LXL04_039045|OH1004|cDNA

ATGAGTGTCGATGATGGTAAGAACTCTGACGGAGAGCAGTTGACATTCGCCACCTACTATTACCAAATCCATTACAAAAACTCCATCGTCGCCAATAGAATTTTTCTTCCAAGTGATGTCAACATCAAAAACGAAGTCGCGCTCGTACCAGCTGAAAATCTGGAACAAGATATTGAATACTTTACACAAATGGGTTTAAGAAGTCCGTTATGGATGCTGATTGTTTGCAGTCAAGTTATGGTAATTGCAGCGGTGACGGA...

CDS

Download CDS FASTA

3012 bp · LXL04_039045|LXL04_039045|OH1004|CDS

ATGAGTGTCGATGATGGTAAGAACTCTGACGGAGAGCAGTTGACATTCGCCACCTACTATTACCAAATCCATTACAAAAACTCCATCGTCGCCAATAGAATTTTTCTTCCAAGTGATGTCAACATCAAAAACGAAGTCGCGCTCGTACCAGCTGAAAATCTGGAACAAGATATTGAATACTTTACACAAATGGGTTTAAGAAGTCCGTTATGGATGCTGATTGTTTGCAGTCAAGTTATGGTAATTGCAGCGGTGACGGA...

Protein

Download Protein FASTA

1003 aa · LXL04_039045|LXL04_039045|OH1004|PROTEIN

MSVDDGKNSDGEQLTFATYYYQIHYKNSIVANRIFLPSDVNIKNEVALVPAENLEQDIEYFTQMGLRSPLWMLIVCSQVMVIAAVTDRNDVAALNAMKSTWKNLPPNWKGPDPCGSNWDGINCTMSRVTSLFLAGMGVRTNNIEDIPSLSQLDYLDLSNNKGIKAPLPPSVGDLKNLKILILVGCSFSGAIPDTVGSLKELVFLGLNNNSFTGTIPPSIGNLKNLSWLDLSDNKLQGPIPVSNGTTLGLDMLKKARHFHL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_039045`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_039045

Location Chr09:57405387-57411526 (-)

Description Similar to At5g49770: Probable leucine-rich repeat receptor-like protein kinase At5g49770

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49760`	Leucine-rich repeat receptor protein kinase that acts as sensor of extracellular hydrogen peroxide.	Hydrogen peroxide sensor HPCA1 is an LRR receptor kinase in Arabidopsis.2020 · DOI: 10.1038/s41586-020-2032-3
`At5g49770`	Probable leucine-rich repeat receptor-like protein kinase At5g49770.	No verified direct reference in this release
`At1g06840`	Probable LRR receptor-like serine/threonine-protein kinase At1g06840.	No verified direct reference in this release
`At5g37450`	Probable LRR receptor-like serine/threonine-protein kinase At5g37450.	No verified direct reference in this release
`At3g53590`	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039045 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009593 detection of chemical stimulus Biological Process

GO:0045088 regulation of innate immune response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0090333 regulation of stomatal closure Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G06840

ath:AT5G37450

ath:AT5G49760

ath:AT5G49770

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.827

Rank 1 · LXL04_039045 · OH-1004

Endoplasmic reticulum0.088

Rank 2 · LXL04_039045 · OH-1004

Cytoplasm0.073

Rank 3 · LXL04_039045 · OH-1004

Nucleus0.043

Rank 4 · LXL04_039045 · OH-1004

Lysosome / Vacuole0.043

Rank 5 · LXL04_039045 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14137-233 aa

PF13855.13LRR_8176-235 aa

PF13855.13LRR_8303-359 aa

PF12799.14LRR_4326-360 aa

PF00069.32Pkinase685-888 aa

PF07714.24PK_Tyr_Ser-Thr688-885 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_039045	`PF23598.2`	LRR_14	137	233	9.6e-14	51.6
LXL04_039045	`PF13855.13`	LRR_8	176	235	9.7e-09	35.6
LXL04_039045	`PF13855.13`	LRR_8	303	359	9.7e-09	35.6
LXL04_039045	`PF12799.14`	LRR_4	326	360	1.5e-10	41.7
LXL04_039045	`PF00069.32`	Pkinase	685	888	2.1e-44	152.7
LXL04_039045	`PF07714.24`	PK_Tyr_Ser-Thr	688	885	3.5e-46	158.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GZ99`	Arabidopsis thaliana	Leucine-rich repeat receptor protein kinase HPCA1	48.608%	Swiss-Prot	moderate database homology
`Q9LT96`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase At5g49770	44.929%	Swiss-Prot	moderate database homology
`C0LGD7`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g06840	37.942%	Swiss-Prot	moderate database homology
`C0LGU1`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At5g37450	35.064%	Swiss-Prot	moderate database homology
`Q9LFG1`	Arabidopsis thaliana	Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At3g53590	35.526%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card