LXL04_038928 | RubberDandelionOmics

Gene overview

LXL04_038928

Reference: OH-1004 Chr: Chr09 Coordinates: 53534892-53536160 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

384 bp · LXL04_038928|LXL04_038928|OH1004|cDNA

ATGGAGTTAGGGTTTTGCATTCCGTCCAGCCGTCGACACTTGCAATACGCAGCAGCCGAAGGAGCTCTCAAATCGCCAGTAATTCCCGATCCAGttgtcaagatGCAGAATGAGGAGGGACAAAACATGGATCTCTACATCCCAAGAAAGTGTTCTGCTACCAATAGGTTGATCACTTCAAAGGATCATGCTTCTGTTCAGATTAATGTTGGTCATTTGGATGAGTCTGGCCGCTATGTTGGCCAGTTTTCCACTTTTGC...

CDS

Download CDS FASTA

384 bp · LXL04_038928|LXL04_038928|OH1004|CDS

ATGGAGTTAGGGTTTTGCATTCCGTCCAGCCGTCGACACTTGCAATACGCAGCAGCCGAAGGAGCTCTCAAATCGCCAGTAATTCCCGATCCAGTTGTCAAGATGCAGAATGAGGAGGGACAAAACATGGATCTCTACATCCCAAGAAAGTGTTCTGCTACCAATAGGTTGATCACTTCAAAGGATCATGCTTCTGTTCAGATTAATGTTGGTCATTTGGATGAGTCTGGCCGCTATGTTGGCCAGTTTTCCACTTTTGC...

Protein

Download Protein FASTA

127 aa · LXL04_038928|LXL04_038928|OH1004|PROTEIN

MELGFCIPSSRRHLQYAAAEGALKSPVIPDPVVKMQNEEGQNMDLYIPRKCSATNRLITSKDHASVQINVGHLDESGRYVGQFSTFALCGEMLIVHLTGCGRRRKLKIANSYFCQFSDGGKMGIFMS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038928`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038928

Location Chr09:53534892-53536160 (+)

Description Similar to RPS21C: 40S ribosomal protein S21-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27700`	Small ribosomal subunit protein eS21y.	No verified direct reference in this release
`At3g53890`	Small ribosomal subunit protein eS21z.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0345200`	Small ribosomal subunit protein eS21.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038928 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000461 endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006412 translation Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

KEGG gene cross-reference

ath:AT3G53890

ath:AT5G27700

dosa:Os03g0345200

zma:542449

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.490

Rank 1 · LXL04_038928 · OH-1004

Nucleus0.328

Rank 2 · LXL04_038928 · OH-1004

Mitochondrion0.193

Rank 3 · LXL04_038928 · OH-1004

Plastid0.066

Rank 4 · LXL04_038928 · OH-1004

Peroxisome0.064

Rank 5 · LXL04_038928 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01249.24Ribosomal_S21e35-92 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038928	`PF01249.24`	Ribosomal_S21e	35	92	8.7e-29	100.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E902`	Arabidopsis thaliana	Small ribosomal subunit protein eS21y	82.143%	Swiss-Prot	weak database homology
`Q9M337`	Arabidopsis thaliana	Small ribosomal subunit protein eS21z	75.000%	Swiss-Prot	weak database homology
`P35687`	Oryza sativa subsp. japonica	Small ribosomal subunit protein eS21	76.786%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card