LXL04_038685 | RubberDandelionOmics

Gene overview

LXL04_038685

Reference: OH-1004 Chr: Chr09 Coordinates: 48104434-48105999 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1467 bp · LXL04_038685|LXL04_038685|OH1004|cDNA

ATGACCTCGATGGGCTCAGATAGGTTTAGAAAGGCAATCGGAAAAGTGAAGGATCACACTAGCATTAGCCTCGCCAGAGTTAGTAGCAGCACCACCTTACCGGATCTCGAAGTCGCAATCGTCAAGGCCACCCGTCACGAGGAGTACCCGGCGGAAGAACGCCACATACAAGAAATCATAACCCTAACCACCGACTCACAACCCTACGTCGCCTCATGTATCAGCTTGATCTCAGCGCGGCTCGACAAGACCAGAAATTG...

CDS

Download CDS FASTA

1467 bp · LXL04_038685|LXL04_038685|OH1004|CDS

ATGACCTCGATGGGCTCAGATAGGTTTAGAAAGGCAATCGGAAAAGTGAAGGATCACACTAGCATTAGCCTCGCCAGAGTTAGTAGCAGCACCACCTTACCGGATCTCGAAGTCGCAATCGTCAAGGCCACCCGTCACGAGGAGTACCCGGCGGAAGAACGCCACATACAAGAAATCATAACCCTAACCACCGACTCACAACCCTACGTCGCCTCATGTATCAGCTTGATCTCAGCGCGGCTCGACAAGACCAGAAATTG...

Protein

Download Protein FASTA

488 aa · LXL04_038685|LXL04_038685|OH1004|PROTEIN

MTSMGSDRFRKAIGKVKDHTSISLARVSSSTTLPDLEVAIVKATRHEEYPAEERHIQEIITLTTDSQPYVASCISLISARLDKTRNWMVALKVLIVIQRLLQDGDPAYEREIFFATRRGTRLLNMFDFRDMSRTNSWDFSAFVRTYSLYLDEYLEYRMQGRQEMHGSYSEEDELKPDPVILISPVNEKSNDNLFSRLQHLIQLLERFLACRPTGSARNHRIVMVALYPIVKQSFNMYYDITDVLSILTDRFKEFEHSDSV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038685`
TK1151 ID	TkA04G455540
OH-1004 ID	LXL04_038685
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 53.689 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038685

Location Chr09:48104434-48105999 (+)

Description Similar to At1g03050: Putative clathrin assembly protein At1g03050

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03050`	Putative clathrin assembly protein At1g03050.	No verified direct reference in this release
`At4g02650`	Putative clathrin assembly protein At4g02650.	No verified direct reference in this release
`At4g32285`	Probable clathrin assembly protein At4g32285.	No verified direct reference in this release
`At1g05020`	Adaptins are components of the adapter complexes which link clathrin to receptors in coated vesicles.	Identification and functional characterization of Arabidopsis AP180, a binding partner of plant alphaC-adaptin.2004 · DOI: 10.1242/jcs.01062
`At4g25940`	Putative clathrin assembly protein At4g25940.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038685 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006900 vesicle budding from membrane Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0015031 protein transport Biological Process

GO:0048268 clathrin coat assembly Biological Process

GO:0072583 clathrin-dependent endocytosis Biological Process

GO:0072659 protein localization to plasma membrane Biological Process

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005905 clathrin-coated pit Cellular Component

GO:0009504 cell plate Cellular Component

KEGG gene cross-reference

ath:AT1G03050

ath:AT1G05020

ath:AT4G02650

ath:AT4G25940

ath:AT4G32285

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.480

Rank 1 · LXL04_038685 · OH-1004

Cytoplasm0.393

Rank 2 · LXL04_038685 · OH-1004

Nucleus0.202

Rank 3 · LXL04_038685 · OH-1004

Golgi apparatus0.070

Rank 4 · LXL04_038685 · OH-1004

Endoplasmic reticulum0.055

Rank 5 · LXL04_038685 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07651.23ANTH35-313 aa

PF01417.27ENTH35-110 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038685	`PF07651.23`	ANTH	35	313	9.1e-79	265.0
LXL04_038685	`PF01417.27`	ENTH	35	110	3.5e-07	31.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SA65`	Arabidopsis thaliana	Putative clathrin assembly protein At1g03050	45.254%	Swiss-Prot	moderate database homology
`Q8GX47`	Arabidopsis thaliana	Putative clathrin assembly protein At4g02650	43.633%	Swiss-Prot	moderate database homology
`Q8S9J8`	Arabidopsis thaliana	Probable clathrin assembly protein At4g32285	35.831%	Swiss-Prot	moderate database homology
`Q9ZVN6`	Arabidopsis thaliana	Clathrin coat assembly protein AP180	40.061%	Swiss-Prot	moderate database homology
`Q8VYT2`	Arabidopsis thaliana	Putative clathrin assembly protein At4g25940	31.144%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card