LXL04_038559 | RubberDandelionOmics

Gene overview

LXL04_038559

Reference: OH-1004 Chr: Chr09 Coordinates: 43904792-43908708 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2349 bp · LXL04_038559|LXL04_038559|OH1004|cDNA

ATGCTTGAAGCAATCGCTTCTTGCCATGGTCCCATGGGCCATGACCTTATTATTCAGCCAAGCATTATAAGATCGCCGCACCATTTTCGACACATTTACAATGGCCCAAATCGATTACTCTACACGCCGGCATTTTCCGCGTATCGCAGGATACAATACTGTTCTCATATGCCTTCAAATCTACCAGATTGTGCACCATTGTTGACTTCCTCGTTTCTTGGTCGGAGACAATCTCAAATTAATCGGAGAGCTTCAGAGAG...

CDS

Download CDS FASTA

2349 bp · LXL04_038559|LXL04_038559|OH1004|CDS

ATGCTTGAAGCAATCGCTTCTTGCCATGGTCCCATGGGCCATGACCTTATTATTCAGCCAAGCATTATAAGATCGCCGCACCATTTTCGACACATTTACAATGGCCCAAATCGATTACTCTACACGCCGGCATTTTCCGCGTATCGCAGGATACAATACTGTTCTCATATGCCTTCAAATCTACCAGATTGTGCACCATTGTTGACTTCCTCGTTTCTTGGTCGGAGACAATCTCAAATTAATCGGAGAGCTTCAGAGAG...

Protein

Download Protein FASTA

782 aa · LXL04_038559|LXL04_038559|OH1004|PROTEIN

MLEAIASCHGPMGHDLIIQPSIIRSPHHFRHIYNGPNRLLYTPAFSAYRRIQYCSHMPSNLPDCAPLLTSSFLGRRQSQINRRASERGGRFRMNAALDVGGAVEVINDLGLDTLTFLAVTVLVVPAFKFVKASPILGFFFAGVVLNQFGLIRNLTDVKVLSEWGILFLLFEMGLELSFARLKALAKFAFGMGLTQVVLSTLAFTAFELPPNKAIGTQILQFLFHSRSDLVNIRSVDEAIVIGAALSLSSSAFVLQLLAEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038559`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038559

Location Chr09:43904792-43908708 (+)

Description Similar to KEA3: K(+) efflux antiporter 3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04850`	May act as an electroneutral K⁺/H⁺ antiporter mediating proton efflux from the thylakoid lumen to the chloroplast stroma.	A novel AtKEA gene family, homolog of bacterial K+/H+ antiporters, plays potential roles in K+ homeostasis and osmotic adjustment in Arabidopsis.2013 · DOI: 10.1371/journal.pone.0081463 Ion antiport accelerates photosynthetic acclimation in fluctuating light environments.2014 · DOI: 10.1038/ncomms6439 Regulation and Levels of the Thylakoid K+/H+ Antiporter KEA3 Shape the Dynamic Response of Photosynthesis in Fluctuating Light.2016 · DOI: 10.1093/pcp/pcw085 Rapid hyperosmotic-induced Ca2+ responses in Arabidopsis thaliana exhibit sensory potentiation and involvement of plastidial KEA transporters.2016 · DOI: 10.1073/pnas.1519555113 Photosynthesis in Arabidopsis Is Unaffected by the Function of the Vacuolar K + Channel TPK3.2019 · DOI: 10.1104/pp.19.00255 K + and Cl - channels/transporters independently fine-tune photosynthesis in plants.2019 · DOI: 10.1038/s41598-019-44972-z Evidence for potassium transport activity of Arabidopsis KEA1-KEA6.2019 · DOI: 10.1038/s41598-019-46463-7 Modification of Activity of the Thylakoid H + /K + Antiporter KEA3 Disturbs ∆pH-Dependent Regulation of Photosynthesis.2019 · DOI: 10.1104/pp.19.00766 H + Transport by K + EXCHANGE ANTIPORTER3 Promotes Photosynthesis and Growth in Chloroplast ATP Synthase Mutants.2020 · DOI: 10.1104/pp.19.01561 Collaboration between NDH and KEA3 Allows Maximally Efficient Photosynthesis after a Long Dark Adaptation.2020 · DOI: 10.1104/pp.20.01069
`At4g00630`	May act as an electroneutral K⁺/H⁺ antiporter regulating monovalent-cation and pH homeostasis in plastids.	Arabidopsis KEA2, a homolog of bacterial KefC, encodes a K(+)/H(+) antiporter with a chloroplast transit peptide.2012 · DOI: 10.1016/j.bbamem.2012.04.011 A novel AtKEA gene family, homolog of bacterial K+/H+ antiporters, plays potential roles in K+ homeostasis and osmotic adjustment in Arabidopsis.2013 · DOI: 10.1371/journal.pone.0081463 Envelope K+/H+ Antiporters AtKEA1 and AtKEA2 Function in Plastid Development.2016 · DOI: 10.1104/pp.16.00995 Plastidial transporters KEA1 and KEA2 at the inner envelope membrane adjust stromal pH in the dark.2021 · DOI: 10.1111/nph.17042 Loss of function of the chloroplast membrane K + /H + antiporters AtKEA1 and AtKEA2 alters the ROS and NO metabolism but promotes drought stress resilience.2021 · DOI: 10.1016/j.plaphy.2021.01.010 Loss of inner-envelope K+/H+ exchangers impairs plastid rRNA maturation and gene expression.2021 · DOI: 10.1093/plcell/koab123 Exogenous sucrose influences KEA1 and KEA2 to regulate abscisic acid-mediated primary root growth in Arabidopsis.2022 · DOI: 10.1016/j.plantsci.2022.111209
`At1g01790`	May act as an electroneutral K⁺/H⁺ antiporter in chloroplast K⁺ homeostasis, osmotic adjustment and plastid development.	A novel AtKEA gene family, homolog of bacterial K+/H+ antiporters, plays potential roles in K+ homeostasis and osmotic adjustment in Arabidopsis.2013 · DOI: 10.1371/journal.pone.0081463 Envelope K+/H+ Antiporters AtKEA1 and AtKEA2 Function in Plastid Development.2016 · DOI: 10.1104/pp.16.00995 Evidence for potassium transport activity of Arabidopsis KEA1-KEA6.2019 · DOI: 10.1038/s41598-019-46463-7 Plastidial transporters KEA1 and KEA2 at the inner envelope membrane adjust stromal pH in the dark.2021 · DOI: 10.1111/nph.17042 Loss of function of the chloroplast membrane K + /H + antiporters AtKEA1 and AtKEA2 alters the ROS and NO metabolism but promotes drought stress resilience.2021 · DOI: 10.1016/j.plaphy.2021.01.010 Loss of inner-envelope K+/H+ exchangers impairs plastid rRNA maturation and gene expression.2021 · DOI: 10.1093/plcell/koab123 Exogenous sucrose influences KEA1 and KEA2 to regulate abscisic acid-mediated primary root growth in Arabidopsis.2022 · DOI: 10.1016/j.plantsci.2022.111209

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038559 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006813 potassium ion transport Biological Process

GO:0006885 regulation of pH Biological Process

GO:0009643 photosynthetic acclimation Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009744 response to sucrose Biological Process

GO:0010109 regulation of photosynthesis Biological Process

GO:0010196 nonphotochemical quenching Biological Process

GO:0019722 calcium-mediated signaling Biological Process

KEGG gene cross-reference

ath:AT1G01790

ath:AT4G00630

ath:AT4G04850

cko:CKO_03334

cko:CKO_04758

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.980

Rank 1 · LXL04_038559 · OH-1004

Cytoplasm0.023

Rank 2 · LXL04_038559 · OH-1004

Peroxisome0.022

Rank 3 · LXL04_038559 · OH-1004

Mitochondrion0.021

Rank 4 · LXL04_038559 · OH-1004

Nucleus0.021

Rank 5 · LXL04_038559 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00999.27Na_H_Exchanger119-500 aa

PF02254.25TrkA_N531-653 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038559	`PF00999.27`	Na_H_Exchanger	119	500	6.5e-66	223.4
LXL04_038559	`PF02254.25`	TrkA_N	531	653	1.6e-14	55.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0Z3`	Arabidopsis thaliana	K(+) efflux antiporter 3, chloroplastic	71.314%	Swiss-Prot	strong database homology
`O65272`	Arabidopsis thaliana	K(+) efflux antiporter 2, chloroplastic	37.523%	Swiss-Prot	moderate database homology
`Q9ZTZ7`	Arabidopsis thaliana	K(+) efflux antiporter 1, chloroplastic	36.918%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card