LXL04_038268 | RubberDandelionOmics

Gene overview

LXL04_038268

Reference: OH-1004 Chr: Chr09 Coordinates: 35991453-35994922 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2610 bp · LXL04_038268|LXL04_038268|OH1004|cDNA

ATGGGGAGTAATTTTGTTGTATTATTGGTGTTGTCGTTGTTGTTACACAGTACATTTGAACAACAACAACTACCACCACCACAAGTTCCGTCCAGATTTAGGGCAGAACGGGCAGCTCTGCTTCAACTTAGATCATCATTAGGGTTAAGATCAAAACAATGGCCGCTAAAGTCCATTCCGTGCTCCAATTGGACCGGAATCTCATGTCAGAACGGCAGTGTCACCGGAATCAACATTTCAGGGTTTAAGCGAACTCGAGC...

CDS

Download CDS FASTA

2610 bp · LXL04_038268|LXL04_038268|OH1004|CDS

ATGGGGAGTAATTTTGTTGTATTATTGGTGTTGTCGTTGTTGTTACACAGTACATTTGAACAACAACAACTACCACCACCACAAGTTCCGTCCAGATTTAGGGCAGAACGGGCAGCTCTGCTTCAACTTAGATCATCATTAGGGTTAAGATCAAAACAATGGCCGCTAAAGTCCATTCCGTGCTCCAATTGGACCGGAATCTCATGTCAGAACGGCAGTGTCACCGGAATCAACATTTCAGGGTTTAAGCGAACTCGAGC...

Protein

Download Protein FASTA

869 aa · LXL04_038268|LXL04_038268|OH1004|PROTEIN

MGSNFVVLLVLSLLLHSTFEQQQLPPPQVPSRFRAERAALLQLRSSLGLRSKQWPLKSIPCSNWTGISCQNGSVTGINISGFKRTRAGRRNPRFAVESLANLTNLASFNASRFTLPGSIPNELGFQLQALQVLDLRFCQISGAIPSTLGNLSNLHELYLSDNSLTGTIPSTLGQLPNLSVLDLSRNSLTGLIPSSFGSLLNLSSLDMSLNYLSGIIPESFGNLPNLSFLNLSGNSLSSSLPTQLFNTTTLTVLDLSSNTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038268`
TK1151 ID	TkA04G412260
OH-1004 ID	LXL04_038268
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 99.885 / OH-1004 99.770 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038268

Location Chr09:35991453-35994922 (+)

Description Similar to At2g16250: Probable LRR receptor-like serine/threonine-protein kinase At2g16250

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g16250`	Probable LRR receptor-like serine/threonine-protein kinase At2g16250.	No verified direct reference in this release
`At5g44700`	Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057
`At4g20140`	Together with GSO2, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons.	GASSHO1 and GASSHO2 encoding a putative leucine-rich repeat transmembrane-type receptor kinase are essential for the normal development of the epidermal surface in Arabidopsis embryos.2008 · DOI: 10.1111/j.1365-313x.2007.03395.x The receptor-like kinases GSO1 and GSO2 together regulate root growth in Arabidopsis through control of cell division and cell fate specification.2014 · DOI: 10.1002/dvdy.24066 A peptide hormone required for Casparian strip diffusion barrier formation in Arabidopsis roots.2017 · DOI: 10.1126/science.aai9057

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0777400`	Receptor kinase that may be involved in the regulation of cell proliferation and cell growth.	No verified direct reference in this release
`Os06g0203800`	Receptor kinase involved in the regulation of thermotolerance.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038268 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001558 regulation of cell growth Biological Process

GO:0010286 heat acclimation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0033612 receptor serine/threonine kinase binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G16250

dosa:Os02g0777400

dosa:Os06g0203800

osa:4340427

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.854

Rank 1 · LXL04_038268 · OH-1004

Endoplasmic reticulum0.076

Rank 2 · LXL04_038268 · OH-1004

Cytoplasm0.068

Rank 3 · LXL04_038268 · OH-1004

Nucleus0.051

Rank 4 · LXL04_038268 · OH-1004

Lysosome / Vacuole0.030

Rank 5 · LXL04_038268 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14117-209 aa

PF13855.13LRR_8129-188 aa

PF12799.14LRR_4129-164 aa

PF12799.14LRR_4153-191 aa

PF13855.13LRR_8176-236 aa

PF23598.2LRR_14218-310 aa

PF00069.32Pkinase498-770 aa

PF07714.24PK_Tyr_Ser-Thr499-772 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038268	`PF23598.2`	LRR_14	117	209	1.2e-13	51.3
LXL04_038268	`PF13855.13`	LRR_8	129	188	1.9e-20	73.1
LXL04_038268	`PF12799.14`	LRR_4	129	164	2.4e-15	56.9
LXL04_038268	`PF12799.14`	LRR_4	153	191	2.4e-15	56.9
LXL04_038268	`PF13855.13`	LRR_8	176	236	1.9e-20	73.1
LXL04_038268	`PF23598.2`	LRR_14	218	310	1.2e-13	51.3
LXL04_038268	`PF00069.32`	Pkinase	498	770	2e-12	47.8
LXL04_038268	`PF07714.24`	PK_Tyr_Ser-Thr	499	772	5.4e-21	75.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGK4`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At2g16250	55.193%	Swiss-Prot	strong database homology
`Q9FIZ3`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO2	31.105%	Swiss-Prot	moderate database homology
`C0LGQ5`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase GSO1	31.096%	Swiss-Prot	moderate database homology
`I1Z695`	Oryza sativa subsp. japonica	LRR receptor-like serine/threonine-protein kinase ER2	31.746%	Swiss-Prot	moderate database homology
`Q69SP5`	Oryza sativa subsp. japonica	LRR receptor-like serine/threonine-protein kinase ER1	30.863%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card