LXL04_038097 | RubberDandelionOmics

Gene overview

LXL04_038097

Reference: OH-1004 Chr: Chr09 Coordinates: 31185531-31188328 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1038 bp · LXL04_038097|LXL04_038097|OH1004|cDNA

ATGTGGGTGAAAGTCAGGGTTTCGATCCTGACTAGGAGCACATATGAGGATTTTCCTAAGAGGTGGTGGGTTCATGACATGGCTGAACCAAAAGGTGGTAGGGGAAAGGAAATACCTACATGGGTAATTGCAAACGGGCTATGCCCACCCATGCAAGGGAGTCCGAGTACTCATAACTATTCGCTATACGGCCCCTTCCCGCCGGTGACGCATCCCGTTATCAAGCTGCACATTAACCACTGTAAGTTTCCAAGTCGTTT...

CDS

Download CDS FASTA

1038 bp · LXL04_038097|LXL04_038097|OH1004|CDS

ATGTGGGTGAAAGTCAGGGTTTCGATCCTGACTAGGAGCACATATGAGGATTTTCCTAAGAGGTGGTGGGTTCATGACATGGCTGAACCAAAAGGTGGTAGGGGAAAGGAAATACCTACATGGGTAATTGCAAACGGGCTATGCCCACCCATGCAAGGGAGTCCGAGTACTCATAACTATTCGCTATACGGCCCCTTCCCGCCGGTGACGCATCCCGTTATCAAGCTGCACATTAACCACTGTAAGTTTCCAAGTCGTTT...

Protein

Download Protein FASTA

345 aa · LXL04_038097|LXL04_038097|OH1004|PROTEIN

MWVKVRVSILTRSTYEDFPKRWWVHDMAEPKGGRGKEIPTWVIANGLCPPMQGSPSTHNYSLYGPFPPVTHPVIKLHINHCKFPSRFLIIVFVIQAYCEEMVEVNKPGQLVPESVLKKQKRNEEWALAKKQETESLKKKNAANRKLIFNRAKQYTKEYEDQQKELIQLKREARLKGGFYVNPEAKMLFIIRIRGINAMDPKSKKILQLLRLRQIFNGVFLKVNKATLNMLHRVEPYVTYGYPNLKSVKELIYKRGYGKLN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038097`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038097

Location Chr09:31185531-31188328 (-)

Description Similar to RPL7D: 60S ribosomal protein L7-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g13580`	Large ribosomal subunit protein uL30w.	No verified direct reference in this release
`At2g01250`	Large ribosomal subunit protein uL30y.	No verified direct reference in this release
`At2g44120`	Large ribosomal subunit protein uL30x.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038097 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0002181 cytoplasmic translation Biological Process

GO:0006364 rRNA processing Biological Process

GO:0006412 translation Biological Process

GO:0006941 striated muscle contraction Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0042273 ribosomal large subunit biogenesis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

KEGG gene cross-reference

ath:AT2G01250

ath:AT2G44120

ath:AT3G13580

mmu:19989

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.765

Rank 1 · LXL04_038097 · OH-1004

Cytoplasm0.139

Rank 2 · LXL04_038097 · OH-1004

Nucleus0.100

Rank 3 · LXL04_038097 · OH-1004

Plastid0.019

Rank 4 · LXL04_038097 · OH-1004

Cell membrane0.017

Rank 5 · LXL04_038097 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08079.18Ribosomal_L30_N111-181 aa

PF00327.26Ribosomal_L30187-237 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038097	`PF08079.18`	Ribosomal_L30_N	111	181	2.8e-25	89.1
LXL04_038097	`PF00327.26`	Ribosomal_L30	187	237	2.2e-17	63.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LHP1`	Arabidopsis thaliana	Large ribosomal subunit protein uL30w	85.593%	Swiss-Prot	moderate database homology
`P60040`	Arabidopsis thaliana	Large ribosomal subunit protein uL30y	85.169%	Swiss-Prot	moderate database homology
`P60039`	Arabidopsis thaliana	Large ribosomal subunit protein uL30x	83.051%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card