Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1527 bp · LXL04_037961|LXL04_037961|OH1004|cDNA
ATGGCGGAAGCTTCCAGGATCTTCCACACCACACTCATGCCTTCATTATCGCAAGCTTTGTCTCCTAGAAAGCCTTGTTCTCTAACCATCACTCAACGAAAAACTTCACCAGCGATCATCCGCTGCACAATATCCACTAGtagcagcagcagcagcagcgATACAGCTAAGGCTTCCACGGCTCCTCAGCCGATACCATGGGGTTGCGAAATTGATTCTCTGGAGAACGCGGCCGCGTTGCAGAAATGGTTGACGGATTC...
1527 bp · LXL04_037961|LXL04_037961|OH1004|CDS
ATGGCGGAAGCTTCCAGGATCTTCCACACCACACTCATGCCTTCATTATCGCAAGCTTTGTCTCCTAGAAAGCCTTGTTCTCTAACCATCACTCAACGAAAAACTTCACCAGCGATCATCCGCTGCACAATATCCACTAGTAGCAGCAGCAGCAGCAGCGATACAGCTAAGGCTTCCACGGCTCCTCAGCCGATACCATGGGGTTGCGAAATTGATTCTCTGGAGAACGCGGCCGCGTTGCAGAAATGGTTGACGGATTC...
Protein
Download Protein FASTA508 aa · LXL04_037961|LXL04_037961|OH1004|PROTEIN
MAEASRIFHTTLMPSLSQALSPRKPCSLTITQRKTSPAIIRCTISTSSSSSSSDTAKASTAPQPIPWGCEIDSLENAAALQKWLTDSGLPPQKMDLRQVDVGERGLVANNNIRKGEKILFVPPSLVISANSEWSFPEAGEVLKRYDVPDWPLIATYLISEASLMKSSRWSNYISALPRQPYSLLYWTRAELDRYLEASQIRERAIERINDVTGTYNDLRDRIFSKHPNLFPEEIFNMETFKWSFGILFSRLVRLPSLDGR...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_037961 |
|---|---|
| TK1151 ID | TkA04G367760 |
| OH-1004 ID | LXL04_037961 |
| Relationship / confidence | Rbh Sequence Supported / Probable |
| Protein identity (%) | 90.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_037961 |
|---|---|
| Location | Chr09:26933824-26937637 (+) |
| Description | Similar to RBCMT: Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0018021 peptidyl-histidine methylation Biological Process GO:0030047 actin modification Biological Process GO:0032259 methylation Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0070472 regulation of uterine smooth muscle contraction Biological Process GO:0000785 chromatin Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0009507 chloroplast Cellular Component GO:0003713 transcription coactivator activity Molecular Function |
| KEGG gene cross-reference | ag:AAA69903 ag:AAC49566 hsa:84193 nta:107778201 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00856.34SET104-308 aaPF09273.17Rubis-subs-bind341-474 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_037961 | PF00856.34 | SET | 104 | 308 | 2.8e-12 | 47.7 |
| LXL04_037961 | PF09273.17 | Rubis-subs-bind | 341 | 474 | 2.8e-22 | 80.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.