LXL04_037769 | RubberDandelionOmics

Gene overview

LXL04_037769

Reference: OH-1004 Chr: Chr09 Coordinates: 20678236-20681981 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1833 bp · LXL04_037769|LXL04_037769|OH1004|cDNA

atgttttccttaaatttcgagatcttGGAACATCATGTACGGTCTACTTACACGACTGAAGTCCTGCTACCACCCAAAAATCAAGAAATTTTGCCTCCCGCTATTTTCCATTTTGCTCCCCCAAAGTCCCAAACCCTCCCACTCGCCAATACTGaagatttgaaaattttgaaattgaGAGAAGTGGTCGAGAAGATGAGGGAAGAAGATATCGAGAAATTGAGAGGAGTCGTCAGAGATTGCGTTAGTAAACATCTATA...

CDS

Download CDS FASTA

1833 bp · LXL04_037769|LXL04_037769|OH1004|CDS

ATGTTTTCCTTAAATTTCGAGATCTTGGAACATCATGTACGGTCTACTTACACGACTGAAGTCCTGCTACCACCCAAAAATCAAGAAATTTTGCCTCCCGCTATTTTCCATTTTGCTCCCCCAAAGTCCCAAACCCTCCCACTCGCCAATACTGAAGATTTGAAAATTTTGAAATTGAGAGAAGTGGTCGAGAAGATGAGGGAAGAAGATATCGAGAAATTGAGAGGAGTCGTCAGAGATTGCGTTAGTAAACATCTATA...

Protein

Download Protein FASTA

610 aa · LXL04_037769|LXL04_037769|OH1004|PROTEIN

MFSLNFEILEHHVRSTYTTEVLLPPKNQEILPPAIFHFAPPKSQTLPLANTEDLKILKLREVVEKMREEDIEKLRGVVRDCVSKHLYSSAIFFADKVAAFTSDPADIYMQAQALFLGRHYRRAFHLLNASQIVLRDLRFRYLAAKCLEELKEWDQCLLMLGEAKVDEYGNFSDTKDSNAMYLDKDSEDREINISSAICFLRGKAYEALENRSQARQWYKAAIRADPLCYEAIECLIENHMLTCEEEKSLLSSLQFAQEDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037769`
TK1151 ID	TkA04G348670
OH-1004 ID	LXL04_037769
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 95.902 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037769

Location Chr09:20678236-20681981 (-)

Description Similar to APC6: Anaphase-promoting complex subunit 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g78770`	Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.	The NOMEGA gene required for female gametophyte development encodes the putative APC6/CDC16 component of the Anaphase Promoting Complex in Arabidopsis.2003 · DOI: 10.1046/j.1365-313x.2003.01925.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037769 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007346 regulation of mitotic cell cycle Biological Process

GO:0010087 phloem or xylem histogenesis Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031145 anaphase-promoting complex-dependent catabolic process Biological Process

GO:0032297 negative regulation of DNA-templated DNA replication initiation Biological Process

GO:0032875 regulation of DNA endoreduplication Biological Process

GO:0045842 positive regulation of mitotic metaphase/anaphase transition Biological Process

GO:0051301 cell division Biological Process

GO:0051445 regulation of meiotic cell cycle Biological Process

GO:0070936 protein K48-linked ubiquitination Biological Process

GO:0070979 protein K11-linked ubiquitination Biological Process

GO:0141198 protein branched polyubiquitination Biological Process

KEGG gene cross-reference

ath:AT1G78770

hsa:8881

mmu:69957

sce:YKL022C

spo:2541592

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.533

Rank 1 · LXL04_037769 · OH-1004

Nucleus0.382

Rank 2 · LXL04_037769 · OH-1004

Golgi apparatus0.109

Rank 3 · LXL04_037769 · OH-1004

Lysosome / Vacuole0.086

Rank 4 · LXL04_037769 · OH-1004

Cell membrane0.065

Rank 5 · LXL04_037769 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12895.14ANAPC384-163 aa

PF13181.13TPR_8524-550 aa

PF13424.13TPR_12524-581 aa

PF00515.35TPR_1525-549 aa

PF13374.13TPR_10525-554 aa

PF13432.13TPR_16526-581 aa

PF12895.14ANAPC3534-594 aa

PF21033.6RMD1-3536-587 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037769	`PF12895.14`	ANAPC3	84	163	9.2e-24	84.3
LXL04_037769	`PF13181.13`	TPR_8	524	550	5.8e-19	67.3
LXL04_037769	`PF13424.13`	TPR_12	524	581	3.5e-13	50.2
LXL04_037769	`PF00515.35`	TPR_1	525	549	1.5e-24	85.5
LXL04_037769	`PF13374.13`	TPR_10	525	554	1.9e-11	44.3
LXL04_037769	`PF13432.13`	TPR_16	526	581	1.3e-09	39.0
LXL04_037769	`PF12895.14`	ANAPC3	534	594	9.2e-24	84.3
LXL04_037769	`PF21033.6`	RMD1-3	536	587	1.9e-08	34.5
LXL04_037769	`PF00515.35`	TPR_1	556	587	1.5e-24	85.5
LXL04_037769	`PF07719.24`	TPR_2	557	586	3.9e-28	95.9
LXL04_037769	`PF13176.13`	TPR_7	557	588	8e-09	35.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B3DNN5`	Arabidopsis thaliana	Anaphase-promoting complex subunit 6	80.000%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card