RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

LXL04_037739
Reference: OH-1004 Chr: Chr09 Coordinates: 19770544-19773947 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2106 bp · LXL04_037739|LXL04_037739|OH1004|cDNA

ATGTCGCATTCACGGAAGCCGGATTCGGGGTTAGGGTTTGATACACTCTCCGATCGCCTCCGGAAGACAGTCACTTGCGGCGGAGATAACACCAATAAACCGGACTTCCGAGAACTTGATTTGGGTTCGCCCATTTCGCCTTTACGAGATGGACCGGCGATTAGTAGCAGCTCTAGCTCATCCGGGTCGGTTTCTGGTCGGACTGGAAATGGACTCCAGGTTGGGTCCGGTACTAGAAAGTCAGACTCCGGTGGGACTCC...

CDS

Download CDS FASTA

2106 bp · LXL04_037739|LXL04_037739|OH1004|CDS

ATGTCGCATTCACGGAAGCCGGATTCGGGGTTAGGGTTTGATACACTCTCCGATCGCCTCCGGAAGACAGTCACTTGCGGCGGAGATAACACCAATAAACCGGACTTCCGAGAACTTGATTTGGGTTCGCCCATTTCGCCTTTACGAGATGGACCGGCGATTAGTAGCAGCTCTAGCTCATCCGGGTCGGTTTCTGGTCGGACTGGAAATGGACTCCAGGTTGGGTCCGGTACTAGAAAGTCAGACTCCGGTGGGACTCC...

Protein

Download Protein FASTA

701 aa · LXL04_037739|LXL04_037739|OH1004|PROTEIN

MSHSRKPDSGLGFDTLSDRLRKTVTCGGDNTNKPDFRELDLGSPISPLRDGPAISSSSSSSGSVSGRTGNGLQVGSGTRKSDSGGTPNNHSGELSVDSSPTFSAGGSRGLKSGHTRSDSGSVSGGHPSIFTGGSSATSPPVNVLPTGNICPSGRVLKTGMMSTRTSKPDVLSLGTGNYGHGSIMRGGSSSGSGSSPTIKSSAAAGKPETPVSGGSNSPYSRRSSMDPEDLKKLGNEEYKKGHFLEALSFYDRAISQSPAN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDLXL04_037739
Source versionOH-1004 / GCA_047496595.1_OSU_TarKok_2.0
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDLXL04_037739
LocationChr09:19770544-19773947 (+)
DescriptionSimilar to TTL1: TPR repeat-containing thioredoxin TTL1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g53300 Involved in responses to osmotic stress and abscisic acid (ABA).
The Arabidopsis tetratricopeptide repeat-containing protein TTL1 is required for osmotic stress responses and abscisic acid sensitivity.2006 · DOI: 10.1104/pp.106.085191
The Arabidopsis tetratricopeptide thioredoxin-like gene family is required for osmotic stress tolerance and male sporogenesis.2012 · DOI: 10.1104/pp.111.188920
At2g42580 Involved in osmotic and salt stress tolerance. No verified direct reference in this release
At3g14950 Plays a role in the transmission of male gametophyte.
The Arabidopsis tetratricopeptide thioredoxin-like gene family is required for osmotic stress tolerance and male sporogenesis.2012 · DOI: 10.1104/pp.111.188920
At3g58620 Involved in osmotic and salt stress tolerance.
The Arabidopsis tetratricopeptide thioredoxin-like gene family is required for osmotic stress tolerance and male sporogenesis.2012 · DOI: 10.1104/pp.111.188920

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_037739 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)
GO:0006950 response to stress Biological Process
GO:0006970 response to osmotic stress Biological Process
GO:0009555 pollen development Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009733 response to auxin Biological Process
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009737 response to abscisic acid Biological Process
GO:0009738 abscisic acid-activated signaling pathway Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process
GO:0010305 leaf vascular tissue pattern formation Biological Process
GO:0005634 nucleus Cellular Component
KEGG gene cross-reference
ath:AT1G53300
ath:AT2G42580
ath:AT3G14950
ath:AT3G58620
ddi:DDB_G0288639
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.545
Rank 1 · LXL04_037739 · OH-1004
Nucleus0.351
Rank 2 · LXL04_037739 · OH-1004
Cell membrane0.086
Rank 3 · LXL04_037739 · OH-1004
Golgi apparatus0.071
Rank 4 · LXL04_037739 · OH-1004
Peroxisome0.065
Rank 5 · LXL04_037739 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13432.13TPR_16232-293 aa
PF13414.13TPR_11234-271 aa
PF07719.24TPR_2261-292 aa
PF14559.13TPR_19275-334 aa
PF25575.1TPR_BSK1_C459-538 aa
PF13414.13TPR_11474-515 aa
PF00515.35TPR_1503-534 aa
PF00085.27Thioredoxin606-688 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
LXL04_037739PF13432.13TPR_162322938e-1142.9
LXL04_037739PF13414.13TPR_112342712.3e-1866.3
LXL04_037739PF07719.24TPR_22612925.2e-2895.5
LXL04_037739PF14559.13TPR_192753343.9e-1659.8
LXL04_037739PF25575.1TPR_BSK1_C4595381.1e-0629.3
LXL04_037739PF13414.13TPR_114745152.3e-1866.3
LXL04_037739PF00515.35TPR_15035344.4e-2587.1
LXL04_037739PF00085.27Thioredoxin6066882.2e-1247.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9MAH1Arabidopsis thalianaTPR repeat-containing thioredoxin TTL159.683%Swiss-Protstrong database homology
Q9SIN1Arabidopsis thalianaInactive TPR repeat-containing thioredoxin TTL345.568%Swiss-Protmoderate database homology
F4IXE4Arabidopsis thalianaTPR repeat-containing thioredoxin TTL247.439%Swiss-Protmoderate database homology
Q84JR9Arabidopsis thalianaTPR repeat-containing thioredoxin TTL446.676%Swiss-Protmoderate database homology

JBrowse

View in Genome Browser