LXL04_037504 | RubberDandelionOmics

Gene overview

LXL04_037504

Reference: OH-1004 Chr: Chr09 Coordinates: 12409519-12415622 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1458 bp · LXL04_037504|LXL04_037504|OH1004|cDNA

ATGTGCCCCAATGAAAAGAAGACACGCATGTTACAATTCTCTAATCCGTTTTCTTTAATGGACGATCTTTTCAGTAAGATAAAGCAACATTTCAATGGTACTTGGGACGCTGTGGAGTCTGATAAGGCAACCTTCGAGTCCATAGTGATGAGACTTCCCATCAAAAGCATATTAACATTCAAATCCATATCAAAATTCTGGTACAAGATAATGTCCACAAAGGATTTCATCGTAATGCACCGATTTTGGTCCAAAAAAAA...

CDS

Download CDS FASTA

1458 bp · LXL04_037504|LXL04_037504|OH1004|CDS

ATGTGCCCCAATGAAAAGAAGACACGCATGTTACAATTCTCTAATCCGTTTTCTTTAATGGACGATCTTTTCAGTAAGATAAAGCAACATTTCAATGGTACTTGGGACGCTGTGGAGTCTGATAAGGCAACCTTCGAGTCCATAGTGATGAGACTTCCCATCAAAAGCATATTAACATTCAAATCCATATCAAAATTCTGGTACAAGATAATGTCCACAAAGGATTTCATCGTAATGCACCGATTTTGGTCCAAAAAAAA...

Protein

Download Protein FASTA

485 aa · LXL04_037504|LXL04_037504|OH1004|PROTEIN

MCPNEKKTRMLQFSNPFSLMDDLFSKIKQHFNGTWDAVESDKATFESIVMRLPIKSILTFKSISKFWYKIMSTKDFIVMHRFWSKKNTKLFTFYDAGDLDDGIVREMHLMEPNGTYSESYMIPGFETLHNPILISSFNGLICCVNYMTPCRKLHDAEVRICNPATRKVLLLPNSHLSAYMPIFGVLYSNKYHMYKVFKFFSDLGHYHMGYSQCEVYSSKTGEWKPIGRISKHPLMNPTRPLVADHVCVNEKLYIFIGDDV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037504`
TK1151 ID	TkA04G314530
OH-1004 ID	LXL04_037504
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.700
Protein coverage (%)	TK1151 98.698 / OH-1004 78.144 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037504

Location Chr09:12409519-12415622 (-)

Description Similar to At5g49610: F-box protein At5g49610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g04690`	Putative F-box only protein 15.	No verified direct reference in this release
`At5g49610`	F-box protein At5g49610.	No verified direct reference in this release
`At5g15660`	Putative F-box protein At5g15660.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037504 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0052542 defense response by callose deposition Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT4G04690

ath:AT5G15660

ath:AT5G49610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.444

Rank 1 · LXL04_037504 · OH-1004

Cytoplasm0.427

Rank 2 · LXL04_037504 · OH-1004

Cell membrane0.148

Rank 3 · LXL04_037504 · OH-1004

Endoplasmic reticulum0.097

Rank 4 · LXL04_037504 · OH-1004

Lysosome / Vacuole0.049

Rank 5 · LXL04_037504 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08268.18FBA_3132-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037504	`PF08268.18`	FBA_3	132	339	1.5e-12	47.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9V1`	Arabidopsis thaliana	Putative F-box only protein 15	24.590%	Swiss-Prot	weak database homology
`Q9FGY4`	Arabidopsis thaliana	F-box protein At5g49610	23.362%	Swiss-Prot	weak database homology
`Q9LFW0`	Arabidopsis thaliana	Putative F-box protein At5g15660	24.138%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card