LXL04_037142 | RubberDandelionOmics

Gene overview

LXL04_037142

Reference: OH-1004 Chr: Chr08 Coordinates: 53948783-53953248 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2649 bp · LXL04_037142|LXL04_037142|OH1004|cDNA

ATGCAAGATAATGAATTTGAAGGTAGGATACCGGATTTTGAACAGAAAAGCTTGAAAGTGAAATGGCCAAATGTCAGAGATGGTataaaaggATCTGCTGCCTCCTCTTTGATGATACCCTGGGAATGTGGCCCGAGTCGCCCAGCCCTGGCTATAAGTTCCCCCGAATGCTCATTCCCGCTTTCACGATTGAATTTCAGTCGCTTAGCTGCAACCATTATCACATTGCGAAGTAACCAGCTCAATGTTTTCAGACAGGG...

CDS

Download CDS FASTA

2649 bp · LXL04_037142|LXL04_037142|OH1004|CDS

ATGCAAGATAATGAATTTGAAGGTAGGATACCGGATTTTGAACAGAAAAGCTTGAAAGTGAAATGGCCAAATGTCAGAGATGGTATAAAAGGATCTGCTGCCTCCTCTTTGATGATACCCTGGGAATGTGGCCCGAGTCGCCCAGCCCTGGCTATAAGTTCCCCCGAATGCTCATTCCCGCTTTCACGATTGAATTTCAGTCGCTTAGCTGCAACCATTATCACATTGCGAAGTAACCAGCTCAATGTTTTCAGACAGGG...

Protein

Download Protein FASTA

882 aa · LXL04_037142|LXL04_037142|OH1004|PROTEIN

MQDNEFEGRIPDFEQKSLKVKWPNVRDGIKGSAASSLMIPWECGPSRPALAISSPECSFPLSRLNFSRLAATIITLRSNQLNVFRQGSRLSSNEAAYGKAATFIRFQPNVTDQKIVCQDHMSGNWSLGSNYHPCSQSRKISIGVVVDSAAKTKCNNGKGVVTELQTSQNVTSAKDFPAERKHKGKEVISPDLGTQNEAPCQEPVHANTYFQNISHPDTISHPKLVSSLPSTSNVLLQASGKKIVSEKDPGSNFASQMFNL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037142`
TK1151 ID	TkA04G000430
OH-1004 ID	LXL04_037142
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.200
Protein coverage (%)	TK1151 99.866 / OH-1004 87.982 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037142

Location Chr08:53948783-53953248 (-)

Description Similar to ASY3: Meiosis-specific protein ASY3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46980`	Required for normal meiosis in male and female gametophytes.	Inter-homolog crossing-over and synapsis in Arabidopsis meiosis are dependent on the chromosome axis protein AtASY3.2012 · DOI: 10.1371/journal.pgen.1002507

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0405500`	Plays a crucial role in homologous chromosome pairing and synapsis in meiosis.	Mutation of the rice gene PAIR3 results in lack of bivalent formation in meiosis.2009 · DOI: 10.1111/j.1365-313x.2009.03870.x PAIR3, an axis-associated protein, is essential for the recruitment of recombination elements onto meiotic chromosomes in rice.2011 · DOI: 10.1091/mbc.e10-08-0667

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037142 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007129 homologous chromosome pairing at meiosis Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0090173 regulation of synaptonemal complex assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005694 chromosome Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT2G46980

dosa:Os10g0405500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.950

Rank 1 · LXL04_037142 · OH-1004

Cytoplasm0.127

Rank 2 · LXL04_037142 · OH-1004

Cell membrane0.026

Rank 3 · LXL04_037142 · OH-1004

Mitochondrion0.013

Rank 4 · LXL04_037142 · OH-1004

Endoplasmic reticulum0.011

Rank 5 · LXL04_037142 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20435.3ASY3-like121-468 aa

PF20435.3ASY3-like696-878 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037142	`PF20435.3`	ASY3-like	121	468	9.7e-51	173.6
LXL04_037142	`PF20435.3`	ASY3-like	696	878	9.7e-51	173.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WR66`	Arabidopsis thaliana	Meiosis-specific protein ASY3	45.503%	Swiss-Prot	weak database homology
`B9G5N1`	Oryza sativa subsp. japonica	Meiosis-specific protein PAIR3	40.244%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card