LXL04_037102 | RubberDandelionOmics

Gene overview

LXL04_037102

Reference: OH-1004 Chr: Chr08 Coordinates: 53197528-53197932 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · LXL04_037102|LXL04_037102|OH1004|cDNA

ATGGGTGATCAAGACTTTCAACAAACACTTGGTGATCTGTTAGAAATCAAAGGCAAATACATGAAAGATTCATCCAGAAATCTTTTGTGGAAGAAAGTTATGGAAGCTCAAGTCAAGAAAACATGGTTAGGAGGTTGGAAAACGAAGATCGCAAGGAATAATACTAAAAAGATGAGAAAGAGTAGTAGACGGAGGGTGCGGCGGGCTGCTCACGGAGGACCCAGAAGGCCGGCTTCCATGGTTATTGAACGCAAGGTTCG...

CDS

Download CDS FASTA

405 bp · LXL04_037102|LXL04_037102|OH1004|CDS

ATGGGTGATCAAGACTTTCAACAAACACTTGGTGATCTGTTAGAAATCAAAGGCAAATACATGAAAGATTCATCCAGAAATCTTTTGTGGAAGAAAGTTATGGAAGCTCAAGTCAAGAAAACATGGTTAGGAGGTTGGAAAACGAAGATCGCAAGGAATAATACTAAAAAGATGAGAAAGAGTAGTAGACGGAGGGTGCGGCGGGCTGCTCACGGAGGACCCAGAAGGCCGGCTTCCATGGTTATTGAACGCAAGGTTCG...

Protein

Download Protein FASTA

134 aa · LXL04_037102|LXL04_037102|OH1004|PROTEIN

MGDQDFQQTLGDLLEIKGKYMKDSSRNLLWKKVMEAQVKKTWLGGWKTKIARNNTKKMRKSSRRRVRRAAHGGPRRPASMVIERKVRTLKKLIPNGESSVGLDGLFIETAEYISELQMRVRIMQAVVDALSSPE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037102`
TK1151 ID	TkA04G003240
OH-1004 ID	LXL04_037102
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.200
Protein coverage (%)	TK1151 100.000 / OH-1004 85.075 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037102

Location Chr08:53197528-53197932 (-)

Description Similar to UPB1: Transcription factor UPBEAT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47270`	Transcription factor that modulates the balance between cellular proliferation and differentiation in root growth.	Transcriptional regulation of ROS controls transition from proliferation to differentiation in the root.2010 · DOI: 10.1016/j.cell.2010.10.020

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037102 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009646 response to absence of light Biological Process

GO:0030154 cell differentiation Biological Process

GO:2000280 regulation of root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0046983 protein dimerization activity Molecular Function

KEGG gene cross-reference

ath:AT2G47270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · LXL04_037102 · OH-1004

Cytoplasm0.071

Rank 2 · LXL04_037102 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_037102 · OH-1004

Plastid0.016

Rank 4 · LXL04_037102 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_037102 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22901`	Arabidopsis thaliana	Transcription factor UPBEAT1	48.438%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card