LXL04_036849 | RubberDandelionOmics

Gene overview

LXL04_036849

Reference: OH-1004 Chr: Chr08 Coordinates: 49149893-49153931 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1437 bp · LXL04_036849|LXL04_036849|OH1004|cDNA

ATGGCGATTTCATCTTCTTCAGCATATGCTCTCACTTTATACGTCTCTTTGATCGTAATTATAATCTCCGGCGTCAACTCACAACCGTTTCTTAACTCGGTGGAGCAAGAATCGGTTTATCGTGTCCTTGAATCGCTCAACTCCGACGTCCCATGGCGGTCGCTCTTTCCCGACGACCTCTGCTCCTCCGCCCCACACGGTGTTGTGTGCGGCTACACCACGATGCCCACCGACACCGACCCCGGAACTGTAAACATTCT...

CDS

Download CDS FASTA

1437 bp · LXL04_036849|LXL04_036849|OH1004|CDS

ATGGCGATTTCATCTTCTTCAGCATATGCTCTCACTTTATACGTCTCTTTGATCGTAATTATAATCTCCGGCGTCAACTCACAACCGTTTCTTAACTCGGTGGAGCAAGAATCGGTTTATCGTGTCCTTGAATCGCTCAACTCCGACGTCCCATGGCGGTCGCTCTTTCCCGACGACCTCTGCTCCTCCGCCCCACACGGTGTTGTGTGCGGCTACACCACGATGCCCACCGACACCGACCCCGGAACTGTAAACATTCT...

Protein

Download Protein FASTA

478 aa · LXL04_036849|LXL04_036849|OH1004|PROTEIN

MAISSSSAYALTLYVSLIVIIISGVNSQPFLNSVEQESVYRVLESLNSDVPWRSLFPDDLCSSAPHGVVCGYTTMPTDTDPGTVNILELNFGYVSDHNPNPPCGPNSTLHDPFIFSAFPYLRKLFFYNCFTQHPISLEAFSRVGSAIEELVFIENPSLFGSLNDSIGNMTSLTRLVITGTNVSGEIPGGFGTLQNLEEATLSRNNFTGTLPENVSSLKKLRILDLNRNGFEGSIPAGIGELQNLMKLDLSLNRFSGDFPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036849`
TK1151 ID	TkA04G020700
OH-1004 ID	LXL04_036849
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.300
Protein coverage (%)	TK1151 91.974 / OH-1004 88.703 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036849

Location Chr08:49149893-49153931 (+)

Description Similar to TMM: Protein TOO MANY MOUTHS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g80080`	Promotes cell fate progression in stomatal development.	No verified direct reference in this release
`At1g13230`	Required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica.	A leucine-rich repeat protein is required for growth promotion and enhanced seed production mediated by the endophytic fungus Piriformospora indica in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03028.x
`At2g42800`	Receptor like protein 29.	No verified direct reference in this release
`At1g17230`	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0917500`	Receptor-like kinase that plays important roles in restricting the number of cells entering into male and female sporogenesis.	The MSP1 gene is necessary to restrict the number of cells entering into male and female sporogenesis and to initiate anther wall formation in rice.2003 · DOI: 10.1105/tpc.012401

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036849 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0008356 asymmetric cell division Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009620 response to fungus Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010375 stomatal complex patterning Biological Process

GO:0010376 stomatal complex formation Biological Process

GO:0044403 biological process involved in symbiotic interaction Biological Process

GO:0045087 innate immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

KEGG gene cross-reference

ath:AT1G13230

ath:AT1G17230

ath:AT1G80080

ath:AT2G42800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.669

Rank 1 · LXL04_036849 · OH-1004

Endoplasmic reticulum0.114

Rank 2 · LXL04_036849 · OH-1004

Cytoplasm0.070

Rank 3 · LXL04_036849 · OH-1004

Extracellular0.070

Rank 4 · LXL04_036849 · OH-1004

Lysosome / Vacuole0.052

Rank 5 · LXL04_036849 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23598.2LRR_14164-381 aa

PF13855.13LRR_8171-229 aa

PF12799.14LRR_4194-228 aa

PF13855.13LRR_8241-277 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036849	`PF23598.2`	LRR_14	164	381	8.9e-13	48.4
LXL04_036849	`PF13855.13`	LRR_8	171	229	5.9e-17	61.9
LXL04_036849	`PF12799.14`	LRR_4	194	228	5.3e-10	39.9
LXL04_036849	`PF13855.13`	LRR_8	241	277	5.9e-17	61.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSD1`	Arabidopsis thaliana	Protein TOO MANY MOUTHS	34.492%	Swiss-Prot	moderate database homology
`Q5PP26`	Arabidopsis thaliana	Piriformospora indica-insensitive protein 2	33.858%	Swiss-Prot	moderate database homology
`Q9SJH6`	Arabidopsis thaliana	Receptor like protein 29	32.713%	Swiss-Prot	moderate database homology
`Q9SHI2`	Arabidopsis thaliana	Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230	38.843%	Swiss-Prot	moderate database homology
`Q8RZV7`	Oryza sativa subsp. japonica	Leucine-rich repeat receptor protein kinase MSP1	35.185%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card