LXL04_036693 | RubberDandelionOmics

Gene overview

LXL04_036693

Reference: OH-1004 Chr: Chr08 Coordinates: 46735306-46736820 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1020 bp · LXL04_036693|LXL04_036693|OH1004|cDNA

ATGGAGTCTCTCTCTATAGGTCTCCCAGCTTCCCGACCATCTCTGAAGAACCCTAAATTTCACAAATTTAAAACACCCAATCCCATTTTCCTTTTCACCAGTTGCAATTTAACCCCCAATTCCATCCGATTCCGTtctcatttcaccaagaaaaAACCCAAATCAACCAAATTAAGCCTCAAATCCCAGTCTCCGACTTTCCTTTTTGTGGGATTACAGTTTCCACTTTCTTCACTTGCTTCTGAAGAAATCCCCATTGA...

CDS

Download CDS FASTA

1020 bp · LXL04_036693|LXL04_036693|OH1004|CDS

ATGGAGTCTCTCTCTATAGGTCTCCCAGCTTCCCGACCATCTCTGAAGAACCCTAAATTTCACAAATTTAAAACACCCAATCCCATTTTCCTTTTCACCAGTTGCAATTTAACCCCCAATTCCATCCGATTCCGTTCTCATTTCACCAAGAAAAAACCCAAATCAACCAAATTAAGCCTCAAATCCCAGTCTCCGACTTTCCTTTTTGTGGGATTACAGTTTCCACTTTCTTCACTTGCTTCTGAAGAAATCCCCATTGA...

Protein

Download Protein FASTA

339 aa · LXL04_036693|LXL04_036693|OH1004|PROTEIN

MESLSIGLPASRPSLKNPKFHKFKTPNPIFLFTSCNLTPNSIRFRSHFTKKKPKSTKLSLKSQSPTFLFVGLQFPLSSLASEEIPIDPSSSRINLESILVSIDDFFNRYPFFVAGVAFIWLFVIPATQEYLRKYKEISALDAFKKLKEDPNAQLLDIRDNKTLRVLDSPNLKIFSKNAVQVEYRDGDDDAFSKKVKENFADPANTTICILDNFDGNSMKVAELLFNNGFKEAYAIRGGVRGNNGWLEIQETFLPPSVHIF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036693`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036693

Location Chr08:46735306-46736820 (+)

Description Similar to STR4A: Rhodanese-like domain-containing protein 4A, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25480`	Rhodanese-like domain-containing protein 4A, chloroplastic.	No verified direct reference in this release
`At4g01050`	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	Tethering of ferredoxin:NADP+ oxidoreductase to thylakoid membranes is mediated by novel chloroplast protein TROL.2009 · DOI: 10.1111/j.1365-313x.2009.03999.x

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2X345`	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	No verified direct reference in this release
`Os02g0257300`	Rhodanese domain-containing protein required for anchoring ferredoxin--NADP reductase to the thylakoid membranes and sustaining efficient linear electron flow (LEF).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036693 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009772 photosynthetic electron transport in photosystem II Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0098807 chloroplast thylakoid membrane protein complex Cellular Component

KEGG gene cross-reference

ath:AT3G25480

ath:AT4G01050

dosa:Os02g0257300

osa:4328925

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.975

Rank 1 · LXL04_036693 · OH-1004

Mitochondrion0.027

Rank 2 · LXL04_036693 · OH-1004

Nucleus0.022

Rank 3 · LXL04_036693 · OH-1004

Cytoplasm0.016

Rank 4 · LXL04_036693 · OH-1004

Cell membrane0.012

Rank 5 · LXL04_036693 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28687.1STR4A_N97-132 aa

PF30980.1STR4_M137-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036693	`PF28687.1`	STR4A_N	97	132	3.3e-23	81.6
LXL04_036693	`PF30980.1`	STR4_M	137	255	1.6e-38	132.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56XR7`	Arabidopsis thaliana	Rhodanese-like domain-containing protein 4A, chloroplastic	60.199%	Swiss-Prot	moderate database homology
`Q9M158`	Arabidopsis thaliana	Rhodanese-like domain-containing protein 4, chloroplastic	43.558%	Swiss-Prot	weak database homology
`A2X345`	Oryza sativa subsp. indica	Protein THYLAKOID RHODANESE-LIKE, chloroplastic	45.217%	Swiss-Prot	weak database homology
`Q6ETQ7`	Oryza sativa subsp. japonica	Protein THYLAKOID RHODANESE-LIKE, chloroplastic	45.217%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card