LXL04_036640 | RubberDandelionOmics

Gene overview

LXL04_036640

Reference: OH-1004 Chr: Chr08 Coordinates: 45829636-45832998 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1911 bp · LXL04_036640|LXL04_036640|OH1004|cDNA

ATGCAATTAGCCGGAAGTGTAGGGCTTCCAAATTCTCAGTTTTTTCTTGATTTCAAGTCTACCCAGTTGGGGAATCCAGCTTTTCTCTATGAACGCAGGTGCACAAAAAAGGTAAACGCTTTAAATTACAGTTTTCTCCATAGTGTTTTTTGTTCTAAATCCTTAAAAACCGGAAATTGTTATAAGCAGGAGATGGGTTTCCTCAAATCAGTGAAGAGAAACAAGAATTTGTGCTCTGTTAGGGCAAAATCGGTTATGAA...

CDS

Download CDS FASTA

1911 bp · LXL04_036640|LXL04_036640|OH1004|CDS

ATGCAATTAGCCGGAAGTGTAGGGCTTCCAAATTCTCAGTTTTTTCTTGATTTCAAGTCTACCCAGTTGGGGAATCCAGCTTTTCTCTATGAACGCAGGTGCACAAAAAAGGTAAACGCTTTAAATTACAGTTTTCTCCATAGTGTTTTTTGTTCTAAATCCTTAAAAACCGGAAATTGTTATAAGCAGGAGATGGGTTTCCTCAAATCAGTGAAGAGAAACAAGAATTTGTGCTCTGTTAGGGCAAAATCGGTTATGAA...

Protein

Download Protein FASTA

636 aa · LXL04_036640|LXL04_036640|OH1004|PROTEIN

MQLAGSVGLPNSQFFLDFKSTQLGNPAFLYERRCTKKVNALNYSFLHSVFCSKSLKTGNCYKQEMGFLKSVKRNKNLCSVRAKSVMNVTKVVEKDDVTEGKSKNSGGDGGGYDAIVIGSGIGGLVAATQLAVKGAKVLVLEKYVIPGGSSGFYERDGYTFDVGSSVMFGFSDKGNLNLITQALAAVGCKMEVIPDPTTVHFHLPNSLSVQVHRKYDDFISELTSKFPHEKEGIHKFYDVCWKIFNSLNSLEVKSLEEPLY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036640`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036640

Location Chr08:45829636-45832998 (-)

Description Similar to CRTISO: Prolycopene isomerase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g06820`	Carotene cis-trans-isomerase that converts 7,9,9'-tri-cis- neurosporene to 9'-cis-neurosporene and 7,9,9',7'-tetra-cis-lycopene (also known as prolycopene) into all-trans-lycopene.	Identification of the carotenoid isomerase provides insight into carotenoid biosynthesis, prolamellar body formation, and photomorphogenesis.2002 · DOI: 10.1105/tpc.010302

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036640 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009662 etioplast organization Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0031969 chloroplast membrane Cellular Component

GO:0016491 oxidoreductase activity Molecular Function

GO:0046608 carotenoid isomerase activity Molecular Function

KEGG gene cross-reference

ath:AT1G06820

dcr:108219304

sly:101267857

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.965

Rank 1 · LXL04_036640 · OH-1004

Mitochondrion0.051

Rank 2 · LXL04_036640 · OH-1004

Cytoplasm0.015

Rank 3 · LXL04_036640 · OH-1004

Nucleus0.012

Rank 4 · LXL04_036640 · OH-1004

Peroxisome0.010

Rank 5 · LXL04_036640 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01266.31DAO113-151 aa

PF00890.31FAD_binding_2113-143 aa

PF13450.13NAD_binding_8116-177 aa

PF01593.31Amino_oxidase121-608 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036640	`PF01266.31`	DAO	113	151	1.6e-09	38.5
LXL04_036640	`PF00890.31`	FAD_binding_2	113	143	9.3e-07	29.1
LXL04_036640	`PF13450.13`	NAD_binding_8	116	177	1.1e-13	51.9
LXL04_036640	`PF01593.31`	Amino_oxidase	121	608	1.5e-19	71.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9Y8`	Arabidopsis thaliana	Prolycopene isomerase, chloroplastic	86.513%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card