LXL04_035897 | RubberDandelionOmics

Gene overview

LXL04_035897

Reference: OH-1004 Chr: Chr08 Coordinates: 31645998-31647090 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

531 bp · LXL04_035897|LXL04_035897|OH1004|cDNA

ATGGCAATCTCCGTCACTGCACCGGCCGCATGTCGTTCGTGGACTTTTGACCGTACCACGCCGTTGGCTTCATCTTCTTCGTCCTCCTCAAGGCTTTCCAATCTATCTTCTCTGCAATTTCATTCACGGATTCCTCGTCTTACTCTCAGTAATCGTCGCTTTTCTACTTCCCCATCTAAGTCTCGAACACTTACCCTGGCTCAAGCAAAGAAGCAATCATTTTCCTCCCTTGATGAACTACTGGAAAAAGCCGAGAAGCC...

CDS

Download CDS FASTA

531 bp · LXL04_035897|LXL04_035897|OH1004|CDS

ATGGCAATCTCCGTCACTGCACCGGCCGCATGTCGTTCGTGGACTTTTGACCGTACCACGCCGTTGGCTTCATCTTCTTCGTCCTCCTCAAGGCTTTCCAATCTATCTTCTCTGCAATTTCATTCACGGATTCCTCGTCTTACTCTCAGTAATCGTCGCTTTTCTACTTCCCCATCTAAGTCTCGAACACTTACCCTGGCTCAAGCAAAGAAGCAATCATTTTCCTCCCTTGATGAACTACTGGAAAAAGCCGAGAAGCC...

Protein

Download Protein FASTA

176 aa · LXL04_035897|LXL04_035897|OH1004|PROTEIN

MAISVTAPAACRSWTFDRTTPLASSSSSSSRLSNLSSLQFHSRIPRLTLSNRRFSTSPSKSRTLTLAQAKKQSFSSLDELLEKAEKPVLVDFYATWCGPCQFMGPILNEVSITMGDALQVVKIDTEKYPEIANKYSIEALPTFILFKDGKPCDRFEGALTANQLIQRIEGTLKVEN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035897`
TK1151 ID	TkA04G098140
OH-1004 ID	LXL04_035897
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 76.923 / OH-1004 62.500 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035897

Location Chr08:31645998-31647090 (-)

Description Similar to Os01g0963400: Thioredoxin Y, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g76760`	Thiol-disulfide oxidoreductase that poorly activates chloroplastic malate dehydrogenase (NADP-MDH) and fructose-1,6-bisphosphatase.	No verified direct reference in this release
`At1g43560`	Thiol-disulfide oxidoreductase that poorly activates chloroplastic malate dehydrogenase (NADP-MDH) and fructose-1,6-bisphosphatase.	No verified direct reference in this release
`At1g50320`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0963400`	Probable thiol-disulfide oxidoreductase that may participate in various redox reactions.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035897 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009416 response to light stimulus Biological Process

GO:0043085 positive regulation of catalytic activity Biological Process

GO:0045454 cell redox homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0008047 enzyme activator activity Molecular Function

GO:0015035 protein-disulfide reductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G43560

ath:AT1G50320

ath:AT1G76760

dosa:Os01g0963400

osa:4324458

syn:slr0233

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.984

Rank 1 · LXL04_035897 · OH-1004

Mitochondrion0.023

Rank 2 · LXL04_035897 · OH-1004

Nucleus0.018

Rank 3 · LXL04_035897 · OH-1004

Cytoplasm0.013

Rank 4 · LXL04_035897 · OH-1004

Cell membrane0.010

Rank 5 · LXL04_035897 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin75-169 aa

PF13098.14Thioredoxin_282-169 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035897	`PF00085.27`	Thioredoxin	75	169	2.8e-27	95.5
LXL04_035897	`PF13098.14`	Thioredoxin_2	82	169	1.7e-09	38.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NPF9`	Arabidopsis thaliana	Thioredoxin Y1, chloroplastic	63.636%	Swiss-Prot	strong database homology
`Q8L7S9`	Arabidopsis thaliana	Thioredoxin Y2, chloroplastic	62.112%	Swiss-Prot	strong database homology
`Q8LD49`	Arabidopsis thaliana	Thioredoxin X, chloroplastic	37.500%	Swiss-Prot	moderate database homology
`Q5JMR9`	Oryza sativa subsp. japonica	Thioredoxin Y, chloroplastic	64.748%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card