LXL04_035854 | RubberDandelionOmics

Gene overview

LXL04_035854

Reference: OH-1004 Chr: Chr08 Coordinates: 30697148-30698945 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1173 bp · LXL04_035854|LXL04_035854|OH1004|cDNA

ATGAGTACTTCTGCAAACGATGTTGAAGATCACGGCGACGTTTTCCTCGACGAGGACGACATCGTAGAAGAAATCAATGTAGACGAAGAAGATCTCCCTGATGCAGATGACGACGCAGGCTCTGACAACGAAGTTTTTGATGAAGCTGATGACTCGATGCACATCTTCACCGCTCACACCGGTGAACTATACACGGTTGCCTGTAGCCCTACAGATCCTATTTTAGTGGCCACAGGTGCAGGTGATGACAAAGGGTTTCT...

CDS

Download CDS FASTA

1173 bp · LXL04_035854|LXL04_035854|OH1004|CDS

ATGAGTACTTCTGCAAACGATGTTGAAGATCACGGCGACGTTTTCCTCGACGAGGACGACATCGTAGAAGAAATCAATGTAGACGAAGAAGATCTCCCTGATGCAGATGACGACGCAGGCTCTGACAACGAAGTTTTTGATGAAGCTGATGACTCGATGCACATCTTCACCGCTCACACCGGTGAACTATACACGGTTGCCTGTAGCCCTACAGATCCTATTTTAGTGGCCACAGGTGCAGGTGATGACAAAGGGTTTCT...

Protein

Download Protein FASTA

390 aa · LXL04_035854|LXL04_035854|OH1004|PROTEIN

MSTSANDVEDHGDVFLDEDDIVEEINVDEEDLPDADDDAGSDNEVFDEADDSMHIFTAHTGELYTVACSPTDPILVATGAGDDKGFLFKLGQGDWAFELQGHNDSVSSVSFSSDGQLVASGSFDGTIRVWDISSLTFKCALDGPGAGIEWVRWHPRGHLILAGSEDSSVWMWNADKGSYLNNFSGHASTVTCGDFTPDGKTICTGSDDASLRIWNPKTGDNIHVVRGHFYHTQGLTCLTITADSSLVLTGSKDGSVHIVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035854`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_035854`
Location	Chr08:30697148-30698945 (-)
Description	Similar to AAMP: Angio-associated migratory cell protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035854` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0010595 positive regulation of endothelial cell migration Biological Process GO:0014909 smooth muscle cell migration Biological Process GO:0030154 cell differentiation Biological Process GO:0180023 cytosolic large ribosomal subunit assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009986 cell surface Cellular Component GO:0030687 preribosome, large subunit precursor Cellular Component GO:0008201 heparin binding Molecular Function
KEGG gene cross-reference	bta:767919 cfa:478908 hsa:14 pon:100172186 spo:2542715 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.702

Rank 1 · LXL04_035854 · OH-1004

Cytoplasm0.573

Rank 2 · LXL04_035854 · OH-1004

Mitochondrion0.036

Rank 3 · LXL04_035854 · OH-1004

Cell membrane0.029

Rank 4 · LXL04_035854 · OH-1004

Lysosome / Vacuole0.023

Rank 5 · LXL04_035854 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24105.2Beta-prop_CAF1B_HIR142-134 aa

PF25175.2Beta-prop_WDR550-134 aa

PF25391.2WD40_Gbeta51-215 aa

PF25173.2Beta-prop_WDR3_1st52-215 aa

PF25174.2Beta-prop_THOC352-160 aa

PF24817.2WD40_WDHD1_1st52-134 aa

PF25171.2Beta-prop_WDR36-Utp21_1st54-175 aa

PF24807.2WD40_CDC20-Fz55-183 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035854	`PF24105.2`	Beta-prop_CAF1B_HIR1	42	134	2.8e-28	99.7
LXL04_035854	`PF25175.2`	Beta-prop_WDR5	50	134	1.6e-81	274.5
LXL04_035854	`PF25391.2`	WD40_Gbeta	51	215	5.2e-29	102.0
LXL04_035854	`PF25173.2`	Beta-prop_WDR3_1st	52	215	5.3e-79	264.9
LXL04_035854	`PF25174.2`	Beta-prop_THOC3	52	160	3e-52	178.0
LXL04_035854	`PF24817.2`	WD40_WDHD1_1st	52	134	9.8e-39	134.0
LXL04_035854	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	54	175	2.3e-26	93.5
LXL04_035854	`PF24807.2`	WD40_CDC20-Fz	55	183	7e-42	144.4
LXL04_035854	`PF24782.3`	WD40_MABP1-WDR62_2nd	58	131	6.9e-22	78.6
LXL04_035854	`PF29037.1`	DSE1_N	61	134	8.8e-16	58.7
LXL04_035854	`PF23381.2`	Beta-prop_IFT122_1st	63	133	1.6e-56	192.4
LXL04_035854	`PF24814.2`	WD40_Prp19	63	228	1.8e-53	182.1
LXL04_035854	`PF23414.2`	Beta-prop_EML_2	63	222	3.9e-37	128.8
LXL04_035854	`PF20426.5`	NBCH_WD40	63	134	1.1e-30	107.4
LXL04_035854	`PF23869.2`	Beta-prop_WDR75_1st	63	161	1.1e-12	48.6
LXL04_035854	`PF24796.2`	WDR55	65	135	7.3e-31	108.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card