LXL04_035738 | RubberDandelionOmics

Gene overview

LXL04_035738

Reference: OH-1004 Chr: Chr08 Coordinates: 27949667-27950029 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

363 bp · LXL04_035738|LXL04_035738|OH1004|cDNA

ATGTTCAACAATAAGTTCTCAGGTTCAATCCCTCCTACATTCAGTTCATGTACAGTGCTTCAAAATCTCGATTTTGGTAATAATTCGTTGGTGGGTGAAATCCCTGATTCGTTTGGTAACTGCACTAAGCTTTATAATGTCAATTTGAGTTTGAATTCGTTGACGGGTTCCGTTCCTGTATCCCTCTCGCAATCCAATTCCCTCATGTTTCTATCTCTCCAATTCAACAATTTTTTAGGGGTTCTTCCTGATTCATTGGG...

CDS

Download CDS FASTA

363 bp · LXL04_035738|LXL04_035738|OH1004|CDS

ATGTTCAACAATAAGTTCTCAGGTTCAATCCCTCCTACATTCAGTTCATGTACAGTGCTTCAAAATCTCGATTTTGGTAATAATTCGTTGGTGGGTGAAATCCCTGATTCGTTTGGTAACTGCACTAAGCTTTATAATGTCAATTTGAGTTTGAATTCGTTGACGGGTTCCGTTCCTGTATCCCTCTCGCAATCCAATTCCCTCATGTTTCTATCTCTCCAATTCAACAATTTTTTAGGGGTTCTTCCTGATTCATTGGG...

Protein

Download Protein FASTA

120 aa · LXL04_035738|LXL04_035738|OH1004|PROTEIN

MFNNKFSGSIPPTFSSCTVLQNLDFGNNSLVGEIPDSFGNCTKLYNVNLSLNSLTGSVPVSLSQSNSLMFLSLQFNNFLGVLPDSLGGGKNGDKSIVKSIRYLFRVKRIERKDYKESKGV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035738`
TK1151 ID	TkA04G112180
OH-1004 ID	LXL04_035738
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035738

Location Chr08:27949667-27950029 (+)

Description Similar to IMK2: Probably inactive leucine-rich repeat receptor-like protein kinase IMK2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51740`	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2.	No verified direct reference in this release
`At3g56100`	Can phosphorylate AGL24.	No verified direct reference in this release
`At4g28650`	Involved in the regulation of procambium maintenance and polarity during vascular-tissue development.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975
`At4g08850`	Acts as a receptor of SCOOP peptides from Brassicaceae plants regulating multiple processing including plant growth, development and stress responses.	A receptor heteromer mediates the male perception of female attractants in plants.2016 · DOI: 10.1038/nature16975 Perception of a divergent family of phytocytokines by the Arabidopsis receptor kinase MIK2.2021 · DOI: 10.1038/s41467-021-20932-y The Arabidopsis MIK2 receptor elicits immunity by sensing a conserved signature from phytocytokines and microbes.2021 · DOI: 10.1038/s41467-021-25580-w The MIK2/SCOOP Signaling System Contributes to Arabidopsis Resistance Against Herbivory by Modulating Jasmonate and Indole Glucosinolate Biosynthesis.2022 · DOI: 10.3389/fpls.2022.852808

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0225300`	May be involved in regulation of plant growth through the brassinosteroid (BR) signaling pathway.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035738 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G51740

ath:AT3G56100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.379

Rank 1 · LXL04_035738 · OH-1004

Endoplasmic reticulum0.152

Rank 2 · LXL04_035738 · OH-1004

Extracellular0.139

Rank 3 · LXL04_035738 · OH-1004

Cytoplasm0.136

Rank 4 · LXL04_035738 · OH-1004

Nucleus0.116

Rank 5 · LXL04_035738 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_820-78 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035738	`PF13855.13`	LRR_8	20	78	6.3e-06	26.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCT4`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase IMK2	52.381%	Swiss-Prot	strong database homology
`C0LGP9`	Arabidopsis thaliana	Probable leucine-rich repeat receptor-like protein kinase IMK3	47.126%	Swiss-Prot	moderate database homology
`Q9M0G7`	Arabidopsis thaliana	MDIS1-interacting receptor like kinase 1	42.353%	Swiss-Prot	moderate database homology
`Q8VZG8`	Arabidopsis thaliana	MDIS1-interacting receptor like kinase 2	40.230%	Swiss-Prot	moderate database homology
`Q67X31`	Oryza sativa subsp. japonica	LRR receptor kinase SERK2	40.964%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card