LXL04_035575 | RubberDandelionOmics

Gene overview

LXL04_035575

Reference: OH-1004 Chr: Chr08 Coordinates: 24857265-24858165 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · LXL04_035575|LXL04_035575|OH1004|cDNA

ATGTCTACCTTCACGTTTTCATGTGACCACTACTCACAAGACTTATCTCCTTACAAGCCATGGCATCCTCTATATAAGGAGCTCGGATTAAGCATAACTGATAGACAAACAAAGACTAAAATGGGTTCATCCGCCTATTGGCAAGTTATTGGAGAAGTTCTTGGAGACATGGACATGGCACAACACTTTGTACCTAGGGTTCCTATGTACATCTACTATGGAATTGGAAAGGTGATAAGTGGTTGTGAACTTAATGCatc...

CDS

Download CDS FASTA

651 bp · LXL04_035575|LXL04_035575|OH1004|CDS

ATGTCTACCTTCACGTTTTCATGTGACCACTACTCACAAGACTTATCTCCTTACAAGCCATGGCATCCTCTATATAAGGAGCTCGGATTAAGCATAACTGATAGACAAACAAAGACTAAAATGGGTTCATCCGCCTATTGGCAAGTTATTGGAGAAGTTCTTGGAGACATGGACATGGCACAACACTTTGTACCTAGGGTTCCTATGTACATCTACTATGGAATTGGAAAGGTGATAAGTGGTTGTGAACTTAATGCATC...

Protein

Download Protein FASTA

216 aa · LXL04_035575|LXL04_035575|OH1004|PROTEIN

MSTFTFSCDHYSQDLSPYKPWHPLYKELGLSITDRQTKTKMGSSAYWQVIGEVLGDMDMAQHFVPRVPMYIYYGIGKVISGCELNASDVKNVPRVYIGGESDELYTLIMIDPDAPNPNEPCLKQVVSWIVTNIHGPTSYTQGTEVVPYEVSNPEVGIHRNIFALYQQQYHIDNVEPPASRVCFNIRDFAARNNLGDPVRVTYFNMRRQSNKRKNRG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035575`
TK1151 ID	TkA04G122700
OH-1004 ID	LXL04_035575
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035575

Location Chr08:24857265-24858165 (+)

Description Similar to MFT: Protein MOTHER of FT and TFL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g18100`	May form complexes with phosphorylated ligands by interfering with kinases and their effectors (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0498800`	May form complexes with phosphorylated ligands by interfering with kinases and their effectors.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035575 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010030 positive regulation of seed germination Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G18100

bdi:100838275

dosa:Os06g0498800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · LXL04_035575 · OH-1004

Nucleus0.444

Rank 2 · LXL04_035575 · OH-1004

Mitochondrion0.091

Rank 3 · LXL04_035575 · OH-1004

Extracellular0.074

Rank 4 · LXL04_035575 · OH-1004

Cell membrane0.065

Rank 5 · LXL04_035575 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01161.27PBP93-203 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035575	`PF01161.27`	PBP	93	203	3.6e-10	41.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XFK7`	Arabidopsis thaliana	Protein MOTHER of FT and TFL1	42.857%	Swiss-Prot	moderate database homology
`Q656A5`	Oryza sativa subsp. japonica	Protein MOTHER of FT and TFL1 homolog 1	39.888%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card