LXL04_035459 | RubberDandelionOmics

Gene overview

LXL04_035459

Reference: OH-1004 Chr: Chr08 Coordinates: 22978555-22979514 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

960 bp · LXL04_035459|LXL04_035459|OH1004|cDNA

ATGGCGAAAGTGGAGGTTGACGACTGTCGAGGGGTGCTCAAAGTTTACAGCGATGGCTCTATCTGGCGATCAACCGAGCCGAGCTTTCAAGTCCCTGTGGCTGACGATGGTTCGGTCCTCTGGAAAGACGTTCTGTTTGACGAACCGAACAACCTCCGCCTCCGTCTTTACAAACCGGCTTCCGCCGTGGGAACGAAACTGCCGGTGTTTTACTACATCCATGGCGGTGGTTTCTGCATCGGTTCACGAACATGGCCTAA...

CDS

Download CDS FASTA

960 bp · LXL04_035459|LXL04_035459|OH1004|CDS

ATGGCGAAAGTGGAGGTTGACGACTGTCGAGGGGTGCTCAAAGTTTACAGCGATGGCTCTATCTGGCGATCAACCGAGCCGAGCTTTCAAGTCCCTGTGGCTGACGATGGTTCGGTCCTCTGGAAAGACGTTCTGTTTGACGAACCGAACAACCTCCGCCTCCGTCTTTACAAACCGGCTTCCGCCGTGGGAACGAAACTGCCGGTGTTTTACTACATCCATGGCGGTGGTTTCTGCATCGGTTCACGAACATGGCCTAA...

Protein

Download Protein FASTA

319 aa · LXL04_035459|LXL04_035459|OH1004|PROTEIN

MAKVEVDDCRGVLKVYSDGSIWRSTEPSFQVPVADDGSVLWKDVLFDEPNNLRLRLYKPASAVGTKLPVFYYIHGGGFCIGSRTWPNCQNYCFKLALSLQAVIVAPDYRLAPENRLTLAVEDGFTSVKWLQSQAAAAEPDPWLVDSADFTRVFISGDSAGGNIAHNVAVRLRAGSKSLEPVQVKGYVLLAPFFGGTKLTDSEAHGPKDAFLNWELIDRFWRLSIPVGETMDHPLVNPFGPVSLDLEPVELDPILVVCGGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_035459`
TK1151 ID	TkA01G100640
OH-1004 ID	LXL04_035459
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	52.800
Protein coverage (%)	TK1151 97.866 / OH-1004 98.119 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_035459

Location Chr08:22978555-22979514 (-)

Description Similar to CXE15: Probable carboxylesterase 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g06570`	May bind strigolactones and catalyze their hydrolysis.	Catabolism of strigolactones by a carboxylesterase.2021 · DOI: 10.1038/s41477-021-01011-y Structural insights into strigolactone catabolism by carboxylesterases reveal a conserved conformational regulation.2024 · DOI: 10.1038/s41467-024-50928-3
`At5g16080`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At1g68620`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_035459 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1901600 strigolactone metabolic process Biological Process

GO:2000032 regulation of secondary shoot formation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0016829 lyase activity Molecular Function

GO:0052689 carboxylic ester hydrolase activity Molecular Function

GO:0106435 carboxylesterase activity Molecular Function

KEGG gene cross-reference

ag:BAM20978

ag:BAM20979

ath:AT1G68620

ath:AT5G06570

ath:AT5G16080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.844

Rank 1 · LXL04_035459 · OH-1004

Nucleus0.287

Rank 2 · LXL04_035459 · OH-1004

Endoplasmic reticulum0.065

Rank 3 · LXL04_035459 · OH-1004

Cell membrane0.047

Rank 4 · LXL04_035459 · OH-1004

Mitochondrion0.040

Rank 5 · LXL04_035459 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00135.35COesterase48-112 aa

PF20434.6BD-FAE56-169 aa

PF07859.20Abhydrolase_371-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_035459	`PF00135.35`	COesterase	48	112	3.1e-08	33.8
LXL04_035459	`PF20434.6`	BD-FAE	56	169	2.8e-10	40.8
LXL04_035459	`PF07859.20`	Abhydrolase_3	71	294	6.7e-58	196.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FG13`	Arabidopsis thaliana	Strigolactones hydrolase CXE15	50.470%	Swiss-Prot	strong database homology
`Q9LFR7`	Arabidopsis thaliana	Probable carboxylesterase 17	33.866%	Swiss-Prot	moderate database homology
`Q9SX25`	Arabidopsis thaliana	Probable carboxylesterase 6	33.538%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card