LXL04_033906 | RubberDandelionOmics

Gene overview

LXL04_033906

Reference: OH-1004 Chr: Chr07 Coordinates: 64680366-64681807 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

894 bp · LXL04_033906|LXL04_033906|OH1004|cDNA

ATGGCCACTCCATCCCCTCTGTTCCACCTGCGAACATCTTTCTTTCACGGTTTCACCATCAACACTACCAGACCCTTCTCTAATCCCTTCATTTCTCCTTTCAAACCCCACCGTTTTCACATCAAATCAACCAAGATGGAAAGACGTGAAATTACGGCGGAAATAGAAGTGGGCGCCGGTGGAAAGAAGAAGATATTTGTATCAGGAGCCACCGGAAAAACTGGAAAGAGGATCGTCGAGCAACTACTGGCCAAGGGTTT...

CDS

Download CDS FASTA

894 bp · LXL04_033906|LXL04_033906|OH1004|CDS

ATGGCCACTCCATCCCCTCTGTTCCACCTGCGAACATCTTTCTTTCACGGTTTCACCATCAACACTACCAGACCCTTCTCTAATCCCTTCATTTCTCCTTTCAAACCCCACCGTTTTCACATCAAATCAACCAAGATGGAAAGACGTGAAATTACGGCGGAAATAGAAGTGGGCGCCGGTGGAAAGAAGAAGATATTTGTATCAGGAGCCACCGGAAAAACTGGAAAGAGGATCGTCGAGCAACTACTGGCCAAGGGTTT...

Protein

Download Protein FASTA

297 aa · LXL04_033906|LXL04_033906|OH1004|PROTEIN

MATPSPLFHLRTSFFHGFTINTTRPFSNPFISPFKPHRFHIKSTKMERREITAEIEVGAGGKKKIFVSGATGKTGKRIVEQLLAKGFAVKAGVRDAEKAKTIFPNLNEDFQIVKADVTEGSDKLAEAIGDDSDAVVCATGFQYSWDLLAPWKVDYYGTVNLVEACRKLGVTKFVLVSSILVNGAAMGQLLNPAYVFLNAFGLVLVAKFQAEQYIRKSGINYTIIRPGGLKNDPPNGNIVMEPEDTLSEGSISRDQVAEVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033906`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033906

Location Chr07:64680366-64681807 (+)

Description Similar to At2g34460: Uncharacterized protein At2g34460, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g34460`	Uncharacterized protein At2g34460, chloroplastic.	No verified direct reference in this release
`At3g18890`	Involved in protein precursor import into chloroplasts.	No verified direct reference in this release
`At2g37660`	Uncharacterized protein At2g37660, chloroplastic.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os10g0100300`	Involved in protein precursor import into chloroplasts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033906 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009706 chloroplast inner membrane Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010287 plastoglobule Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT2G34460

ath:AT2G37660

ath:AT3G18890

dosa:Os10g0100300

osa:4347935

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.981

Rank 1 · LXL04_033906 · OH-1004

Mitochondrion0.032

Rank 2 · LXL04_033906 · OH-1004

Cytoplasm0.022

Rank 3 · LXL04_033906 · OH-1004

Cell membrane0.015

Rank 4 · LXL04_033906 · OH-1004

Peroxisome0.015

Rank 5 · LXL04_033906 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05368.20NmrA62-224 aa

PF01370.28Epimerase65-226 aa

PF16363.12GDP_Man_Dehyd66-179 aa

PF01073.263Beta_HSD67-185 aa

PF13460.13NAD_binding_1069-267 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033906	`PF05368.20`	NmrA	62	224	4e-15	56.9
LXL04_033906	`PF01370.28`	Epimerase	65	226	6.4e-12	46.1
LXL04_033906	`PF16363.12`	GDP_Man_Dehyd	66	179	1.1e-06	29.1
LXL04_033906	`PF01073.26`	3Beta_HSD	67	185	7.7e-10	39.0
LXL04_033906	`PF13460.13`	NAD_binding_10	69	267	8.3e-46	156.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H124`	Arabidopsis thaliana	Uncharacterized protein At2g34460, chloroplastic	66.102%	Swiss-Prot	strong database homology
`Q8H0U5`	Arabidopsis thaliana	Protein TIC 62, chloroplastic	35.686%	Swiss-Prot	moderate database homology
`O80934`	Arabidopsis thaliana	Uncharacterized protein At2g37660, chloroplastic	30.502%	Swiss-Prot	moderate database homology
`Q10A77`	Oryza sativa subsp. japonica	Protein TIC 62, chloroplastic	33.858%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card