LXL04_032800 | RubberDandelionOmics

Gene overview

LXL04_032800

Reference: OH-1004 Chr: Chr07 Coordinates: 29458031-29460359 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1758 bp · LXL04_032800|LXL04_032800|OH1004|cDNA

ATGGGAAATAATTGCGTGCAGGGGCCCCAGCGTACTGGCTTTTTTTCATCTGTTACAGCAGCAGTCTGGAAAAACCGGCCACCGGCGAACTCTCTTCCCCCTCCCAATTCCAACGATCCGTCCACCCaaaacaagaacaacaacaatGCCAACGACAAGAAACCAGATGATCCGAGTCACAAGGAATCTGAAAAACCACGAGATGTGCAAAGTACCCCGCCAGGTGCTGTTAAAATGTCAGAACAGGAGGCGGCTAAATC...

CDS

Download CDS FASTA

1758 bp · LXL04_032800|LXL04_032800|OH1004|CDS

ATGGGAAATAATTGCGTGCAGGGGCCCCAGCGTACTGGCTTTTTTTCATCTGTTACAGCAGCAGTCTGGAAAAACCGGCCACCGGCGAACTCTCTTCCCCCTCCCAATTCCAACGATCCGTCCACCCAAAACAAGAACAACAACAATGCCAACGACAAGAAACCAGATGATCCGAGTCACAAGGAATCTGAAAAACCACGAGATGTGCAAAGTACCCCGCCAGGTGCTGTTAAAATGTCAGAACAGGAGGCGGCTAAATC...

Protein

Download Protein FASTA

585 aa · LXL04_032800|LXL04_032800|OH1004|PROTEIN

MGNNCVQGPQRTGFFSSVTAAVWKNRPPANSLPPPNSNDPSTQNKNNNNANDKKPDDPSHKESEKPRDVQSTPPGAVKMSEQEAAKSGDKAKVTDDKARAQDKPKAATNFKRVQSMGLKDSVLQRRTGNMKEVYSMGKKLGQGQFGTTFLCTEKESGKEFACKSIAKRKLTTKEDVEDVRREIQIMHHLAGHPNVINIVGAYEDAVAVHVVMELCAGGELFDRIIQRGHYTEKKAAELARIIVGVVESCHSLGVMHRDLK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_032800`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_032800

Location Chr07:29458031-29460359 (+)

Description Similar to CPK20: Calcium-dependent protein kinase 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38910`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At5g04870`	May play a role in signal transduction pathways that involve calcium as a second messenger.	A calcium-dependent protein kinase can inhibit a calmodulin-stimulated Ca2+ pump (ACA2) located in the endoplasmic reticulum of Arabidopsis.2000 · DOI: 10.1073/pnas.97.11.6224
`At3g10660`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0788500`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`Os03g0789000`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_032800 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043067 regulation of programmed cell death Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:1900055 regulation of leaf senescence Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT2G38910

ath:AT3G10660

ath:AT5G04870

dosa:Os03g0788500

dosa:Os03g0789000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.620

Rank 1 · LXL04_032800 · OH-1004

Cytoplasm0.346

Rank 2 · LXL04_032800 · OH-1004

Nucleus0.178

Rank 3 · LXL04_032800 · OH-1004

Golgi apparatus0.084

Rank 4 · LXL04_032800 · OH-1004

Endoplasmic reticulum0.068

Rank 5 · LXL04_032800 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase134-392 aa

PF07714.24PK_Tyr_Ser-Thr136-387 aa

PF21008.4AIF-1434-502 aa

PF00036.39EF-hand_1440-466 aa

PF13499.13EF-hand_7440-500 aa

PF13405.13EF-hand_6440-468 aa

PF13202.13EF-hand_5440-462 aa

PF24548.2EF_EFCAB10_C440-476 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_032800	`PF00069.32`	Pkinase	134	392	5.3e-78	262.7
LXL04_032800	`PF07714.24`	PK_Tyr_Ser-Thr	136	387	1.1e-26	94.4
LXL04_032800	`PF21008.4`	AIF-1	434	502	2.1e-08	35.3
LXL04_032800	`PF00036.39`	EF-hand_1	440	466	2e-32	109.0
LXL04_032800	`PF13499.13`	EF-hand_7	440	500	2.9e-31	108.3
LXL04_032800	`PF13405.13`	EF-hand_6	440	468	2e-26	89.8
LXL04_032800	`PF13202.13`	EF-hand_5	440	462	1.7e-25	88.0
LXL04_032800	`PF24548.2`	EF_EFCAB10_C	440	476	7.4e-08	32.6
LXL04_032800	`PF14658.13`	EF-hand_9	442	500	6.7e-08	33.6
LXL04_032800	`PF13833.13`	EF-hand_8	452	502	6.8e-18	64.9
LXL04_032800	`PF00036.39`	EF-hand_1	478	501	2e-32	109.0
LXL04_032800	`PF13499.13`	EF-hand_7	509	571	2.9e-31	108.3
LXL04_032800	`PF13405.13`	EF-hand_6	512	540	2e-26	89.8
LXL04_032800	`PF00036.39`	EF-hand_1	514	538	2e-32	109.0
LXL04_032800	`PF13202.13`	EF-hand_5	514	533	1.7e-25	88.0
LXL04_032800	`PF00036.39`	EF-hand_1	546	572	2e-32	109.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZV15`	Arabidopsis thaliana	Calcium-dependent protein kinase 20	71.843%	Swiss-Prot	strong database homology
`Q06850`	Arabidopsis thaliana	Calcium-dependent protein kinase 1	65.296%	Swiss-Prot	strong database homology
`Q38870`	Arabidopsis thaliana	Calcium-dependent protein kinase 2	62.780%	Swiss-Prot	strong database homology
`Q6F3A6`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 10	67.291%	Swiss-Prot	strong database homology
`Q852N6`	Oryza sativa subsp. japonica	Calcium-dependent protein kinase 11	76.812%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card